Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitoferrin-1

Gene

Slc25a37

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. The iron delivered into the mitochondria, presumably as Fe2+, is then probably delivered to ferrochelatase to catalyze Fe2+ incorporation into protoprophyrin IX to make heme.1 Publication

GO - Molecular functioni

  • iron ion transmembrane transporter activity Source: UniProtKB

GO - Biological processi

  • iron ion homeostasis Source: UniProtKB-KW
  • iron ion transmembrane transport Source: GOC
  • mitochondrial iron ion transport Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Ion transport, Iron transport, Transport

Keywords - Ligandi

Iron

Enzyme and pathway databases

ReactomeiREACT_300408. Mitochondrial iron-sulfur cluster biogenesis.

Protein family/group databases

TCDBi2.A.29.5.5. the mitochondrial carrier (mc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitoferrin-1
Alternative name(s):
Mitochondrial iron transporter 1
Mitochondrial solute carrier protein
Solute carrier family 25 member 37
Gene namesi
Name:Slc25a37
Synonyms:Mfrn, Mscp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1914962. Slc25a37.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei45 – 6420Helical; Name=1Sequence AnalysisAdd
BLAST
Transmembranei106 – 12520Helical; Name=2Sequence AnalysisAdd
BLAST
Transmembranei143 – 16220Helical; Name=3Sequence AnalysisAdd
BLAST
Transmembranei200 – 21920Helical; Name=4Sequence AnalysisAdd
BLAST
Transmembranei234 – 25320Helical; Name=5Sequence AnalysisAdd
BLAST
Transmembranei301 – 32020Helical; Name=6Sequence AnalysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • mitochondrial inner membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 338338Mitoferrin-1PRO_0000235252Add
BLAST

Proteomic databases

PRIDEiQ920G8.

PTM databases

PhosphoSiteiQ920G8.

Expressioni

Tissue specificityi

Highly expressed in hematopoietic organs, fetal liver, bone marrow and spleen.2 Publications

Developmental stagei

In the developing embryo, it is first detected at embryonic day 7.5 (E7.5) in the extraembryonic yolk sac, coincident with the appearance of blood islands. Later, restricted expression is seen in E14.5 fetal liver, the primary source of erythrocyte production in mid-gestation. Expression decreases in the spleen around 4-5 weeks of age, suggesting that it is decreased during splenic lymphocyte maturation.1 Publication

Gene expression databases

BgeeiQ920G8.
CleanExiMM_SLC25A37.
ExpressionAtlasiQ920G8. baseline and differential.
GenevisibleiQ920G8. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000039990.

Structurei

3D structure databases

ProteinModelPortaliQ920G8.
SMRiQ920G8. Positions 27-327.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati43 – 13189Solcar 1Add
BLAST
Repeati141 – 22585Solcar 2Add
BLAST
Repeati232 – 32695Solcar 3Add
BLAST

Sequence similaritiesi

Contains 3 Solcar repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG261622.
GeneTreeiENSGT00550000074721.
HOGENOMiHOG000038810.
HOVERGENiHBG079464.
InParanoidiQ920G8.
KOiK15113.
OMAiANAFRMV.
OrthoDBiEOG77DJ7B.
PhylomeDBiQ920G8.
TreeFamiTF314118.

Family and domain databases

Gene3Di1.50.40.10. 1 hit.
InterProiIPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF00153. Mito_carr. 3 hits.
[Graphical view]
SUPFAMiSSF103506. SSF103506. 1 hit.
PROSITEiPS50920. SOLCAR. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q920G8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELRRGGVGN QAAGRRMDGD CRDGGCGSKD AGSEDYENLP TSASVSTHMT
60 70 80 90 100
AGAMAGILEH SIMYPVDSVK TRMQSLNPDP KARYTSIYGA LKRIMHTEGF
110 120 130 140 150
WRPLRGLNVM MMGAGPAHAM YFACYENMKR TLNDVFSHQG NSHLANGVAG
160 170 180 190 200
SMATLLHDAV MNPAEVVKQR LQMYNSQHQS AFSCIRTVWR TEGLGAFYRS
210 220 230 240 250
YTTQLTMNIP FQSIHFITYE FLQEQVNPRR DYNPQSHIIS GGLAGALAAA
260 270 280 290 300
ATTPLDVCKT LLNTQENMAL SLANVSGRLS GMANAFRTVY QLNGLAGYFK
310 320 330
GIQARVIYQM PSTAISWSVY EFFKYILTKR QLENRTLY
Length:338
Mass (Da):37,510
Last modified:December 1, 2001 - v1
Checksum:iBB35B1F70C56A3FE
GO
Isoform 2 (identifier: Q920G8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     148-182: VAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQSAF → ILKAFVWSWEALLSGASSPGPSNLHPRQTENSRVT
     183-338: Missing.

Show »
Length:182
Mass (Da):19,838
Checksum:i18E2C5E801228693
GO
Isoform 3 (identifier: Q920G8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-112: TRMQSLNPDP...PLRGLNVMMM → GHCSASLNLK...AQLVVGTEVL
     113-338: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):11,616
Checksum:iD001C82BEE13BBFB
GO
Isoform 4 (identifier: Q920G8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-81: TRMQSLNPDPK → MDYLSPEKRIY
     82-338: Missing.

Note: No experimental confirmation available.
Show »
Length:81
Mass (Da):8,673
Checksum:i658FB174AEEA27FB
GO
Isoform 5 (identifier: Q920G8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-108: TRMQSLNPDP...GFWRPLRGLN → GHCSASLNLK...SLPNAQDIGK
     109-338: Missing.

Note: No experimental confirmation available.
Show »
Length:108
Mass (Da):11,219
Checksum:iF5491966426FFD83
GO

Sequence cautioni

The sequence BAB29978.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC25649.1 differs from that shown. Reason: Frameshift at positions 141 and 196. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti115 – 1151G → R in BAC25649 (PubMed:16141072).Curated
Sequence conflicti138 – 1381H → P in BAC25649 (PubMed:16141072).Curated
Sequence conflicti141 – 1411N → T in BAC25649 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei71 – 11242TRMQS…NVMMM → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQLVVGTE VL in isoform 3. 1 PublicationVSP_018405Add
BLAST
Alternative sequencei71 – 10838TRMQS…LRGLN → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQDIGK in isoform 5. 1 PublicationVSP_018406Add
BLAST
Alternative sequencei71 – 8111TRMQSLNPDPK → MDYLSPEKRIY in isoform 4. 1 PublicationVSP_018407Add
BLAST
Alternative sequencei82 – 338257Missing in isoform 4. 1 PublicationVSP_018408Add
BLAST
Alternative sequencei109 – 338230Missing in isoform 5. 1 PublicationVSP_018409Add
BLAST
Alternative sequencei113 – 338226Missing in isoform 3. 1 PublicationVSP_018410Add
BLAST
Alternative sequencei148 – 18235VAGSM…HQSAF → ILKAFVWSWEALLSGASSPG PSNLHPRQTENSRVT in isoform 2. 2 PublicationsVSP_018411Add
BLAST
Alternative sequencei183 – 338156Missing in isoform 2. 2 PublicationsVSP_018412Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF288621 mRNA. Translation: AAL23859.1.
AF361699 mRNA. Translation: AAL27990.1.
AK015790 mRNA. Translation: BAB29978.1. Different initiation.
AK019700 mRNA. Translation: BAB31839.2.
AK021203 mRNA. Translation: BAC25649.1. Frameshift.
AK050414 mRNA. Translation: BAC34243.1.
AK086749 mRNA. Translation: BAC39735.1.
CCDSiCCDS27238.1. [Q920G8-1]
RefSeqiNP_080607.2. NM_026331.3. [Q920G8-1]
UniGeneiMm.291443.
Mm.293635.
Mm.489765.

Genome annotation databases

EnsembliENSMUST00000037064; ENSMUSP00000039990; ENSMUSG00000034248. [Q920G8-1]
ENSMUST00000179116; ENSMUSP00000135940; ENSMUSG00000093954. [Q920G8-4]
ENSMUST00000183695; ENSMUSP00000138883; ENSMUSG00000093954. [Q920G8-3]
ENSMUST00000183840; ENSMUSP00000138845; ENSMUSG00000093954. [Q920G8-5]
ENSMUST00000184816; ENSMUSP00000138904; ENSMUSG00000093954. [Q920G8-3]
ENSMUST00000184914; ENSMUSP00000139104; ENSMUSG00000034248. [Q920G8-2]
GeneIDi67712.
KEGGimmu:67712.
UCSCiuc029sla.1. mouse. [Q920G8-1]
uc029sll.1. mouse. [Q920G8-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF288621 mRNA. Translation: AAL23859.1.
AF361699 mRNA. Translation: AAL27990.1.
AK015790 mRNA. Translation: BAB29978.1. Different initiation.
AK019700 mRNA. Translation: BAB31839.2.
AK021203 mRNA. Translation: BAC25649.1. Frameshift.
AK050414 mRNA. Translation: BAC34243.1.
AK086749 mRNA. Translation: BAC39735.1.
CCDSiCCDS27238.1. [Q920G8-1]
RefSeqiNP_080607.2. NM_026331.3. [Q920G8-1]
UniGeneiMm.291443.
Mm.293635.
Mm.489765.

3D structure databases

ProteinModelPortaliQ920G8.
SMRiQ920G8. Positions 27-327.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000039990.

Protein family/group databases

TCDBi2.A.29.5.5. the mitochondrial carrier (mc) family.

PTM databases

PhosphoSiteiQ920G8.

Proteomic databases

PRIDEiQ920G8.

Protocols and materials databases

DNASUi67712.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000037064; ENSMUSP00000039990; ENSMUSG00000034248. [Q920G8-1]
ENSMUST00000179116; ENSMUSP00000135940; ENSMUSG00000093954. [Q920G8-4]
ENSMUST00000183695; ENSMUSP00000138883; ENSMUSG00000093954. [Q920G8-3]
ENSMUST00000183840; ENSMUSP00000138845; ENSMUSG00000093954. [Q920G8-5]
ENSMUST00000184816; ENSMUSP00000138904; ENSMUSG00000093954. [Q920G8-3]
ENSMUST00000184914; ENSMUSP00000139104; ENSMUSG00000034248. [Q920G8-2]
GeneIDi67712.
KEGGimmu:67712.
UCSCiuc029sla.1. mouse. [Q920G8-1]
uc029sll.1. mouse. [Q920G8-4]

Organism-specific databases

CTDi51312.
MGIiMGI:1914962. Slc25a37.

Phylogenomic databases

eggNOGiNOG261622.
GeneTreeiENSGT00550000074721.
HOGENOMiHOG000038810.
HOVERGENiHBG079464.
InParanoidiQ920G8.
KOiK15113.
OMAiANAFRMV.
OrthoDBiEOG77DJ7B.
PhylomeDBiQ920G8.
TreeFamiTF314118.

Enzyme and pathway databases

ReactomeiREACT_300408. Mitochondrial iron-sulfur cluster biogenesis.

Miscellaneous databases

ChiTaRSiSlc25a37. mouse.
NextBioi325341.
PROiQ920G8.
SOURCEiSearch...

Gene expression databases

BgeeiQ920G8.
CleanExiMM_SLC25A37.
ExpressionAtlasiQ920G8. baseline and differential.
GenevisibleiQ920G8. MM.

Family and domain databases

Gene3Di1.50.40.10. 1 hit.
InterProiIPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF00153. Mito_carr. 3 hits.
[Graphical view]
SUPFAMiSSF103506. SSF103506. 1 hit.
PROSITEiPS50920. SOLCAR. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Rapid decrease of RNA level of a novel mouse mitochondria solute carrier protein (Mscp) gene at 4-5 weeks of age."
    Li Q.-Z., Eckenrode S., Ruan Q.-G., Wang C.-Y., Shi J.-D., McIndoe R.A., She J.-X.
    Mamm. Genome 12:830-836(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
    Strain: C57BL/6J.
    Tissue: Liver and Testis.
  3. Lubec G., Sunyer B., Chen W.-Q.
    Submitted (JAN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 288-305, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: OF1.
    Tissue: Hippocampus.
  4. Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiMFRN1_MOUSE
AccessioniPrimary (citable) accession number: Q920G8
Secondary accession number(s): Q8C367
, Q8CEJ7, Q91ZY0, Q9D2G3, Q9D547
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: July 22, 2015
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.