Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q920G8 (MFRN1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 99. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Mitoferrin-1
Alternative name(s):
Mitochondrial iron transporter 1
Mitochondrial solute carrier protein
Solute carrier family 25 member 37
Gene names
Name:Slc25a37
Synonyms:Mfrn, Mscp
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length338 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. The iron delivered into the mitochondria, presumably as Fe2+, is then probably delivered to ferrochelatase to catalyze Fe2+ incorporation into protoprophyrin IX to make heme. Ref.4

Subcellular location

Mitochondrion inner membrane; Multi-pass membrane protein By similarity.

Tissue specificity

Highly expressed in hematopoietic organs, fetal liver, bone marrow and spleen. Ref.1 Ref.4

Developmental stage

In the developing embryo, it is first detected at embryonic day 7.5 (E7.5) in the extraembryonic yolk sac, coincident with the appearance of blood islands. Later, restricted expression is seen in E14.5 fetal liver, the primary source of erythrocyte production in mid-gestation. Expression decreases in the spleen around 4-5 weeks of age, suggesting that it is decreased during splenic lymphocyte maturation. Ref.4

Sequence similarities

Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]

Contains 3 Solcar repeats.

Sequence caution

The sequence BAB29978.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAC25649.1 differs from that shown. Reason: Frameshift at positions 141 and 196.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q920G8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q920G8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     148-182: VAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQSAF → ILKAFVWSWEALLSGASSPGPSNLHPRQTENSRVT
     183-338: Missing.
Isoform 3 (identifier: Q920G8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     71-112: TRMQSLNPDP...PLRGLNVMMM → GHCSASLNLK...AQLVVGTEVL
     113-338: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q920G8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     71-81: TRMQSLNPDPK → MDYLSPEKRIY
     82-338: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q920G8-5)

The sequence of this isoform differs from the canonical sequence as follows:
     71-108: TRMQSLNPDP...GFWRPLRGLN → GHCSASLNLK...SLPNAQDIGK
     109-338: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 338338Mitoferrin-1
PRO_0000235252

Regions

Transmembrane45 – 6420Helical; Name=1; Potential
Transmembrane106 – 12520Helical; Name=2; Potential
Transmembrane143 – 16220Helical; Name=3; Potential
Transmembrane200 – 21920Helical; Name=4; Potential
Transmembrane234 – 25320Helical; Name=5; Potential
Transmembrane301 – 32020Helical; Name=6; Potential
Repeat43 – 13189Solcar 1
Repeat141 – 22585Solcar 2
Repeat232 – 32695Solcar 3

Natural variations

Alternative sequence71 – 11242TRMQS…NVMMM → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQLVVGTE VL in isoform 3.
VSP_018405
Alternative sequence71 – 10838TRMQS…LRGLN → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQDIGK in isoform 5.
VSP_018406
Alternative sequence71 – 8111TRMQSLNPDPK → MDYLSPEKRIY in isoform 4.
VSP_018407
Alternative sequence82 – 338257Missing in isoform 4.
VSP_018408
Alternative sequence109 – 338230Missing in isoform 5.
VSP_018409
Alternative sequence113 – 338226Missing in isoform 3.
VSP_018410
Alternative sequence148 – 18235VAGSM…HQSAF → ILKAFVWSWEALLSGASSPG PSNLHPRQTENSRVT in isoform 2.
VSP_018411
Alternative sequence183 – 338156Missing in isoform 2.
VSP_018412

Experimental info

Sequence conflict1151G → R in BAC25649. Ref.2
Sequence conflict1381H → P in BAC25649. Ref.2
Sequence conflict1411N → T in BAC25649. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: BB35B1F70C56A3FE

FASTA33837,510
        10         20         30         40         50         60 
MELRRGGVGN QAAGRRMDGD CRDGGCGSKD AGSEDYENLP TSASVSTHMT AGAMAGILEH 

        70         80         90        100        110        120 
SIMYPVDSVK TRMQSLNPDP KARYTSIYGA LKRIMHTEGF WRPLRGLNVM MMGAGPAHAM 

       130        140        150        160        170        180 
YFACYENMKR TLNDVFSHQG NSHLANGVAG SMATLLHDAV MNPAEVVKQR LQMYNSQHQS 

       190        200        210        220        230        240 
AFSCIRTVWR TEGLGAFYRS YTTQLTMNIP FQSIHFITYE FLQEQVNPRR DYNPQSHIIS 

       250        260        270        280        290        300 
GGLAGALAAA ATTPLDVCKT LLNTQENMAL SLANVSGRLS GMANAFRTVY QLNGLAGYFK 

       310        320        330 
GIQARVIYQM PSTAISWSVY EFFKYILTKR QLENRTLY 

« Hide

Isoform 2 [UniParc].

Checksum: 18E2C5E801228693
Show »

FASTA18219,838
Isoform 3 [UniParc].

Checksum: D001C82BEE13BBFB
Show »

FASTA11211,616
Isoform 4 [UniParc].

Checksum: 658FB174AEEA27FB
Show »

FASTA818,673
Isoform 5 [UniParc].

Checksum: F5491966426FFD83
Show »

FASTA10811,219

References

« Hide 'large scale' references
[1]"Rapid decrease of RNA level of a novel mouse mitochondria solute carrier protein (Mscp) gene at 4-5 weeks of age."
Li Q.-Z., Eckenrode S., Ruan Q.-G., Wang C.-Y., Shi J.-D., McIndoe R.A., She J.-X.
Mamm. Genome 12:830-836(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
Strain: C57BL/6J.
Tissue: Liver and Testis.
[3]Lubec G., Sunyer B., Chen W.-Q.
Submitted (JAN-2009) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 288-305, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: OF1.
Tissue: Hippocampus.
[4]"Mitoferrin is essential for erythroid iron assimilation."
Shaw G.C., Cope J.J., Li L., Corson K., Hersey C., Ackermann G.E., Gwynn B., Lambert A.J., Wingert R.A., Traver D., Trede N.S., Barut B.A., Zhou Y., Minet E., Donovan A., Brownlie A., Balzan R., Weiss M.J. expand/collapse author list , Peters L.L., Kaplan J., Zon L.I., Paw B.H.
Nature 440:96-100(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF288621 mRNA. Translation: AAL23859.1.
AF361699 mRNA. Translation: AAL27990.1.
AK015790 mRNA. Translation: BAB29978.1. Different initiation.
AK019700 mRNA. Translation: BAB31839.2.
AK021203 mRNA. Translation: BAC25649.1. Frameshift.
AK050414 mRNA. Translation: BAC34243.1.
AK086749 mRNA. Translation: BAC39735.1.
RefSeqNP_080607.2. NM_026331.3.
UniGeneMm.291443.
Mm.293635.
Mm.489765.

3D structure databases

ProteinModelPortalQ920G8.
SMRQ920G8. Positions 27-327.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

TCDB2.A.29.5.5. the mitochondrial carrier (mc) family.

PTM databases

PhosphoSiteQ920G8.

Proteomic databases

PRIDEQ920G8.

Protocols and materials databases

DNASU67712.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000037064; ENSMUSP00000039990; ENSMUSG00000034248. [Q920G8-1]
ENSMUST00000179116; ENSMUSP00000135940; ENSMUSG00000093954. [Q920G8-4]
ENSMUST00000183695; ENSMUSP00000138883; ENSMUSG00000093954. [Q920G8-3]
ENSMUST00000183840; ENSMUSP00000138845; ENSMUSG00000093954. [Q920G8-5]
ENSMUST00000184816; ENSMUSP00000138904; ENSMUSG00000093954. [Q920G8-3]
ENSMUST00000184914; ENSMUSP00000139104; ENSMUSG00000034248. [Q920G8-2]
GeneID67712.
KEGGmmu:100862085.
mmu:67712.
UCSCuc029sla.1. mouse. [Q920G8-1]
uc029sll.1. mouse. [Q920G8-4]

Organism-specific databases

CTD51312.
MGIMGI:1914962. Slc25a37.

Phylogenomic databases

eggNOGNOG261622.
GeneTreeENSGT00550000074721.
HOGENOMHOG000038810.
HOVERGENHBG079464.
InParanoidQ920G8.
KOK15113.
OMAMDGDSRD.
OrthoDBEOG77DJ7B.
PhylomeDBQ920G8.
TreeFamTF314118.

Enzyme and pathway databases

ReactomeREACT_188937. Metabolism.

Gene expression databases

ArrayExpressQ920G8.
BgeeQ920G8.
CleanExMM_SLC25A37.
GenevestigatorQ920G8.

Family and domain databases

Gene3D1.50.40.10. 1 hit.
InterProIPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamPF00153. Mito_carr. 3 hits.
[Graphical view]
SUPFAMSSF103506. SSF103506. 1 hit.
PROSITEPS50920. SOLCAR. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSLC25A37. mouse.
NextBio325341.
PROQ920G8.
SOURCESearch...

Entry information

Entry nameMFRN1_MOUSE
AccessionPrimary (citable) accession number: Q920G8
Secondary accession number(s): Q8C367 expand/collapse secondary AC list , Q8CEJ7, Q91ZY0, Q9D2G3, Q9D547
Entry history
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: April 16, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot