Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q920G8

- MFRN1_MOUSE

UniProt

Q920G8 - MFRN1_MOUSE

Protein

Mitoferrin-1

Gene

Slc25a37

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. The iron delivered into the mitochondria, presumably as Fe2+, is then probably delivered to ferrochelatase to catalyze Fe2+ incorporation into protoprophyrin IX to make heme.1 Publication

    GO - Molecular functioni

    1. iron ion transmembrane transporter activity Source: UniProtKB

    GO - Biological processi

    1. iron ion homeostasis Source: UniProtKB-KW
    2. iron ion transmembrane transport Source: GOC
    3. mitochondrial iron ion transport Source: UniProtKB

    Keywords - Biological processi

    Ion transport, Iron transport, Transport

    Keywords - Ligandi

    Iron

    Enzyme and pathway databases

    ReactomeiREACT_199053. Mitochondrial iron-sulfur cluster biogenesis.

    Protein family/group databases

    TCDBi2.A.29.5.5. the mitochondrial carrier (mc) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mitoferrin-1
    Alternative name(s):
    Mitochondrial iron transporter 1
    Mitochondrial solute carrier protein
    Solute carrier family 25 member 37
    Gene namesi
    Name:Slc25a37
    Synonyms:Mfrn, Mscp
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 14

    Organism-specific databases

    MGIiMGI:1914962. Slc25a37.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. mitochondrial inner membrane Source: UniProtKB

    Keywords - Cellular componenti

    Membrane, Mitochondrion, Mitochondrion inner membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 338338Mitoferrin-1PRO_0000235252Add
    BLAST

    Proteomic databases

    PRIDEiQ920G8.

    PTM databases

    PhosphoSiteiQ920G8.

    Expressioni

    Tissue specificityi

    Highly expressed in hematopoietic organs, fetal liver, bone marrow and spleen.2 Publications

    Developmental stagei

    In the developing embryo, it is first detected at embryonic day 7.5 (E7.5) in the extraembryonic yolk sac, coincident with the appearance of blood islands. Later, restricted expression is seen in E14.5 fetal liver, the primary source of erythrocyte production in mid-gestation. Expression decreases in the spleen around 4-5 weeks of age, suggesting that it is decreased during splenic lymphocyte maturation.1 Publication

    Gene expression databases

    ArrayExpressiQ920G8.
    BgeeiQ920G8.
    CleanExiMM_SLC25A37.
    GenevestigatoriQ920G8.

    Structurei

    3D structure databases

    ProteinModelPortaliQ920G8.
    SMRiQ920G8. Positions 27-329.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei45 – 6420Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei106 – 12520Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei143 – 16220Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei200 – 21920Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei234 – 25320Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei301 – 32020Helical; Name=6Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati43 – 13189Solcar 1Add
    BLAST
    Repeati141 – 22585Solcar 2Add
    BLAST
    Repeati232 – 32695Solcar 3Add
    BLAST

    Sequence similaritiesi

    Contains 3 Solcar repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG261622.
    GeneTreeiENSGT00550000074721.
    HOGENOMiHOG000038810.
    HOVERGENiHBG079464.
    InParanoidiQ920G8.
    KOiK15113.
    OMAiFKGIQAR.
    OrthoDBiEOG77DJ7B.
    PhylomeDBiQ920G8.
    TreeFamiTF314118.

    Family and domain databases

    Gene3Di1.50.40.10. 1 hit.
    InterProiIPR018108. Mitochondrial_sb/sol_carrier.
    IPR023395. Mt_carrier_dom.
    [Graphical view]
    PfamiPF00153. Mito_carr. 3 hits.
    [Graphical view]
    SUPFAMiSSF103506. SSF103506. 1 hit.
    PROSITEiPS50920. SOLCAR. 3 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q920G8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MELRRGGVGN QAAGRRMDGD CRDGGCGSKD AGSEDYENLP TSASVSTHMT    50
    AGAMAGILEH SIMYPVDSVK TRMQSLNPDP KARYTSIYGA LKRIMHTEGF 100
    WRPLRGLNVM MMGAGPAHAM YFACYENMKR TLNDVFSHQG NSHLANGVAG 150
    SMATLLHDAV MNPAEVVKQR LQMYNSQHQS AFSCIRTVWR TEGLGAFYRS 200
    YTTQLTMNIP FQSIHFITYE FLQEQVNPRR DYNPQSHIIS GGLAGALAAA 250
    ATTPLDVCKT LLNTQENMAL SLANVSGRLS GMANAFRTVY QLNGLAGYFK 300
    GIQARVIYQM PSTAISWSVY EFFKYILTKR QLENRTLY 338
    Length:338
    Mass (Da):37,510
    Last modified:December 1, 2001 - v1
    Checksum:iBB35B1F70C56A3FE
    GO
    Isoform 2 (identifier: Q920G8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         148-182: VAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQSAF → ILKAFVWSWEALLSGASSPGPSNLHPRQTENSRVT
         183-338: Missing.

    Show »
    Length:182
    Mass (Da):19,838
    Checksum:i18E2C5E801228693
    GO
    Isoform 3 (identifier: Q920G8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         71-112: TRMQSLNPDP...PLRGLNVMMM → GHCSASLNLK...AQLVVGTEVL
         113-338: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:112
    Mass (Da):11,616
    Checksum:iD001C82BEE13BBFB
    GO
    Isoform 4 (identifier: Q920G8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         71-81: TRMQSLNPDPK → MDYLSPEKRIY
         82-338: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:81
    Mass (Da):8,673
    Checksum:i658FB174AEEA27FB
    GO
    Isoform 5 (identifier: Q920G8-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         71-108: TRMQSLNPDP...GFWRPLRGLN → GHCSASLNLK...SLPNAQDIGK
         109-338: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:108
    Mass (Da):11,219
    Checksum:iF5491966426FFD83
    GO

    Sequence cautioni

    The sequence BAC25649.1 differs from that shown. Reason: Frameshift at positions 141 and 196.
    The sequence BAB29978.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti115 – 1151G → R in BAC25649. (PubMed:16141072)Curated
    Sequence conflicti138 – 1381H → P in BAC25649. (PubMed:16141072)Curated
    Sequence conflicti141 – 1411N → T in BAC25649. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei71 – 11242TRMQS…NVMMM → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQLVVGTE VL in isoform 3. 1 PublicationVSP_018405Add
    BLAST
    Alternative sequencei71 – 10838TRMQS…LRGLN → GHCSASLNLKFINSARMVGP TASWMGLSSLPNAQDIGK in isoform 5. 1 PublicationVSP_018406Add
    BLAST
    Alternative sequencei71 – 8111TRMQSLNPDPK → MDYLSPEKRIY in isoform 4. 1 PublicationVSP_018407Add
    BLAST
    Alternative sequencei82 – 338257Missing in isoform 4. 1 PublicationVSP_018408Add
    BLAST
    Alternative sequencei109 – 338230Missing in isoform 5. 1 PublicationVSP_018409Add
    BLAST
    Alternative sequencei113 – 338226Missing in isoform 3. 1 PublicationVSP_018410Add
    BLAST
    Alternative sequencei148 – 18235VAGSM…HQSAF → ILKAFVWSWEALLSGASSPG PSNLHPRQTENSRVT in isoform 2. 2 PublicationsVSP_018411Add
    BLAST
    Alternative sequencei183 – 338156Missing in isoform 2. 2 PublicationsVSP_018412Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF288621 mRNA. Translation: AAL23859.1.
    AF361699 mRNA. Translation: AAL27990.1.
    AK015790 mRNA. Translation: BAB29978.1. Different initiation.
    AK019700 mRNA. Translation: BAB31839.2.
    AK021203 mRNA. Translation: BAC25649.1. Frameshift.
    AK050414 mRNA. Translation: BAC34243.1.
    AK086749 mRNA. Translation: BAC39735.1.
    CCDSiCCDS27238.1. [Q920G8-1]
    RefSeqiNP_080607.2. NM_026331.3. [Q920G8-1]
    UniGeneiMm.291443.
    Mm.293635.
    Mm.489765.

    Genome annotation databases

    EnsembliENSMUST00000037064; ENSMUSP00000039990; ENSMUSG00000034248. [Q920G8-1]
    ENSMUST00000179116; ENSMUSP00000135940; ENSMUSG00000093954. [Q920G8-4]
    ENSMUST00000183695; ENSMUSP00000138883; ENSMUSG00000093954. [Q920G8-3]
    ENSMUST00000183840; ENSMUSP00000138845; ENSMUSG00000093954. [Q920G8-5]
    ENSMUST00000184816; ENSMUSP00000138904; ENSMUSG00000093954. [Q920G8-3]
    ENSMUST00000184914; ENSMUSP00000139104; ENSMUSG00000034248. [Q920G8-2]
    GeneIDi67712.
    KEGGimmu:67712.
    UCSCiuc029sla.1. mouse. [Q920G8-1]
    uc029sll.1. mouse. [Q920G8-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF288621 mRNA. Translation: AAL23859.1 .
    AF361699 mRNA. Translation: AAL27990.1 .
    AK015790 mRNA. Translation: BAB29978.1 . Different initiation.
    AK019700 mRNA. Translation: BAB31839.2 .
    AK021203 mRNA. Translation: BAC25649.1 . Frameshift.
    AK050414 mRNA. Translation: BAC34243.1 .
    AK086749 mRNA. Translation: BAC39735.1 .
    CCDSi CCDS27238.1. [Q920G8-1 ]
    RefSeqi NP_080607.2. NM_026331.3. [Q920G8-1 ]
    UniGenei Mm.291443.
    Mm.293635.
    Mm.489765.

    3D structure databases

    ProteinModelPortali Q920G8.
    SMRi Q920G8. Positions 27-329.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    TCDBi 2.A.29.5.5. the mitochondrial carrier (mc) family.

    PTM databases

    PhosphoSitei Q920G8.

    Proteomic databases

    PRIDEi Q920G8.

    Protocols and materials databases

    DNASUi 67712.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000037064 ; ENSMUSP00000039990 ; ENSMUSG00000034248 . [Q920G8-1 ]
    ENSMUST00000179116 ; ENSMUSP00000135940 ; ENSMUSG00000093954 . [Q920G8-4 ]
    ENSMUST00000183695 ; ENSMUSP00000138883 ; ENSMUSG00000093954 . [Q920G8-3 ]
    ENSMUST00000183840 ; ENSMUSP00000138845 ; ENSMUSG00000093954 . [Q920G8-5 ]
    ENSMUST00000184816 ; ENSMUSP00000138904 ; ENSMUSG00000093954 . [Q920G8-3 ]
    ENSMUST00000184914 ; ENSMUSP00000139104 ; ENSMUSG00000034248 . [Q920G8-2 ]
    GeneIDi 67712.
    KEGGi mmu:67712.
    UCSCi uc029sla.1. mouse. [Q920G8-1 ]
    uc029sll.1. mouse. [Q920G8-4 ]

    Organism-specific databases

    CTDi 51312.
    MGIi MGI:1914962. Slc25a37.

    Phylogenomic databases

    eggNOGi NOG261622.
    GeneTreei ENSGT00550000074721.
    HOGENOMi HOG000038810.
    HOVERGENi HBG079464.
    InParanoidi Q920G8.
    KOi K15113.
    OMAi FKGIQAR.
    OrthoDBi EOG77DJ7B.
    PhylomeDBi Q920G8.
    TreeFami TF314118.

    Enzyme and pathway databases

    Reactomei REACT_199053. Mitochondrial iron-sulfur cluster biogenesis.

    Miscellaneous databases

    ChiTaRSi SLC25A37. mouse.
    NextBioi 325341.
    PROi Q920G8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q920G8.
    Bgeei Q920G8.
    CleanExi MM_SLC25A37.
    Genevestigatori Q920G8.

    Family and domain databases

    Gene3Di 1.50.40.10. 1 hit.
    InterProi IPR018108. Mitochondrial_sb/sol_carrier.
    IPR023395. Mt_carrier_dom.
    [Graphical view ]
    Pfami PF00153. Mito_carr. 3 hits.
    [Graphical view ]
    SUPFAMi SSF103506. SSF103506. 1 hit.
    PROSITEi PS50920. SOLCAR. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Rapid decrease of RNA level of a novel mouse mitochondria solute carrier protein (Mscp) gene at 4-5 weeks of age."
      Li Q.-Z., Eckenrode S., Ruan Q.-G., Wang C.-Y., Shi J.-D., McIndoe R.A., She J.-X.
      Mamm. Genome 12:830-836(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
      Strain: C57BL/6J.
      Tissue: Liver and Testis.
    3. Lubec G., Sunyer B., Chen W.-Q.
      Submitted (JAN-2009) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 288-305, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: OF1.
      Tissue: Hippocampus.
    4. Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

    Entry informationi

    Entry nameiMFRN1_MOUSE
    AccessioniPrimary (citable) accession number: Q920G8
    Secondary accession number(s): Q8C367
    , Q8CEJ7, Q91ZY0, Q9D2G3, Q9D547
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 16, 2006
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 104 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3