Q920A7 (AFG31_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: AFG3-like protein 1 EC=3.4.24.- | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 789 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Putative ATP-dependent protease. |
| Cofactor | Binds 1 zinc ion per subunit Potential. |
| Subcellular location | Mitochondrion membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | In the N-terminal section; belongs to the AAA ATPase family. In the C-terminal section; belongs to the peptidase M41 family. |
| Caution | The orthologous human gene is a pseudogene. |
| Sequence caution | The sequence AAK66971.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB28211.3 differs from that shown. Reason: Frameshift at position 599. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q920A7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q920A7-2) The sequence of this isoform differs from the canonical sequence as follows: 548-584: LEKKTQVLQPSEKTTVAYHEAGHAVVGWFLEHADPLL → VHHTSRQGAWLRPVPSPRAVPLHTRAALRPHVYDAGG 585-789: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 789 | 789 | AFG3-like protein 1 | PRO_0000084672 | |||||
Regions | |||||||||
| Transmembrane | 139 – 158 | 20 | Helical; Potential | ||||||
| Transmembrane | 246 – 264 | 19 | Helical; Potential | ||||||
| Nucleotide binding | 340 – 347 | 8 | ATP Potential | ||||||
Sites | |||||||||
| Active site | 567 | 1 | By similarity | ||||||
| Metal binding | 566 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 570 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 641 | 1 | Zinc; catalytic By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 548 – 584 | 37 | LEKKT…ADPLL → VHHTSRQGAWLRPVPSPRAV PLHTRAALRPHVYDAGG in isoform 2. | VSP_031809 | |||||
| Alternative sequence | 585 – 789 | 205 | Missing in isoform 2. | VSP_031810 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: BALB/c, C57BL/6J and DBA/2. Tissue: Embryo, Erythroleukemia and Thymic lymphoma. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6. Tissue: Brain. |
| [3] | "Molecular and functional analyses of the human and mouse genes encoding AFG3L1, a mitochondrial metalloprotease homologous to the human spastic paraplegia protein." Kremmidiotis G., Gardner A.E., Settasatian C., Savoia A., Sutherland G.R., Callen D.F. Genomics 76:58-65(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 5-789 (ISOFORM 1). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK012394 mRNA. Translation: BAB28211.3. Frameshift. AK159647 mRNA. Translation: BAE35259.1. AK167964 mRNA. Translation: BAE39961.1. AK168244 mRNA. Translation: BAE40194.1. BC056978 mRNA. Translation: AAH56978.1. AF329695 mRNA. Translation: AAK66971.1. Different initiation. |
| IPI | IPI00468514. IPI00652659. |
| RefSeq | NP_473411.2. NM_054070.3. |
| UniGene | Mm.287475. |
3D structure databases | |
| ProteinModelPortal | Q920A7. |
| SMR | Q920A7. Positions 162-244, 288-728. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q920A7. 1 interaction. |
| STRING | 10090.ENSMUSP00000001520. |
Protein family/group databases | |
| MEROPS | M41.016. |
PTM databases | |
| PhosphoSite | Q920A7. |
Proteomic databases | |
| PaxDb | Q920A7. |
| PRIDE | Q920A7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000001520; ENSMUSP00000001520; ENSMUSG00000031967. ENSMUST00000098320; ENSMUSP00000095924; ENSMUSG00000031967. |
| GeneID | 114896. |
| KEGG | mmu:114896. |
| UCSC | uc009nwd.2. mouse. |
Organism-specific databases | |
| CTD | 114896. |
| MGI | MGI:1928277. Afg3l1. |
Phylogenomic databases | |
| eggNOG | COG0465. |
| GeneTree | ENSGT00530000063070. |
| HOGENOM | HOG000217277. |
| HOVERGEN | HBG050184. |
| InParanoid | Q920A7. |
| KO | K08956. |
| OMA | WDEKDFR. |
| OrthoDB | EOG4SBDXC. |
Gene expression databases | |
| Bgee | Q920A7. |
| CleanEx | MM_AFG3L1. |
| Genevestigator | Q920A7. |
| GermOnline | ENSMUSG00000031967. Mus musculus. |
Family and domain databases | |
| InterPro | IPR003593. AAA+_ATPase. IPR003959. ATPase_AAA_core. IPR003960. ATPase_AAA_CS. IPR005936. FtsH. IPR011546. Pept_M41_FtsH_extracell. IPR000642. Peptidase_M41. [Graphical view] |
| Pfam | PF00004. AAA. 1 hit. PF06480. FtsH_ext. 1 hit. PF01434. Peptidase_M41. 1 hit. [Graphical view] |
| SMART | SM00382. AAA. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR01241. FtsH_fam. 1 hit. |
| PROSITE | PS00674. AAA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 368917. |
| SOURCE | Search... |
Entry information
| Entry name | AFG31_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q920A7 Secondary accession number(s): Q3THK2, Q6PGJ7, Q9CZN2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
