Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

AFG3-like protein 1

Gene

Afg3l1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Putative ATP-dependent protease.

Cofactori

Zn2+CuratedNote: Binds 1 zinc ion per subunit.Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi566Zinc; catalyticBy similarity1
Active sitei567By similarity1
Metal bindingi570Zinc; catalyticBy similarity1
Metal bindingi641Zinc; catalyticBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi340 – 347ATPSequence analysis8

GO - Molecular functioni

GO - Biological processi

  • cristae formation Source: MGI
  • mitochondrial fusion Source: MGI
  • mitochondrial protein processing Source: MGI
  • mitochondrion organization Source: MGI
  • protein complex assembly Source: GO_Central
  • protein import into mitochondrial intermembrane space Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Protein family/group databases

MEROPSiM41.016.

Names & Taxonomyi

Protein namesi
Recommended name:
AFG3-like protein 1 (EC:3.4.24.-)
Gene namesi
Name:Afg3l1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1928277. Afg3l1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei139 – 158HelicalSequence analysisAdd BLAST20
Transmembranei246 – 264HelicalSequence analysisAdd BLAST19

GO - Cellular componenti

  • m-AAA complex Source: MGI
  • mitochondrion Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000846721 – 789AFG3-like protein 1Add BLAST789

Proteomic databases

EPDiQ920A7.
PaxDbiQ920A7.
PeptideAtlasiQ920A7.
PRIDEiQ920A7.

PTM databases

iPTMnetiQ920A7.
PhosphoSitePlusiQ920A7.

Expressioni

Gene expression databases

BgeeiENSMUSG00000031967.
CleanExiMM_AFG3L1.
GenevisibleiQ920A7. MM.

Interactioni

Protein-protein interaction databases

IntActiQ920A7. 1 interactor.
MINTiMINT-1605207.
STRINGi10090.ENSMUSP00000001520.

Structurei

3D structure databases

ProteinModelPortaliQ920A7.
SMRiQ920A7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

In the N-terminal section; belongs to the AAA ATPase family.Curated
In the C-terminal section; belongs to the peptidase M41 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0731. Eukaryota.
COG0465. LUCA.
GeneTreeiENSGT00860000133808.
HOGENOMiHOG000217277.
HOVERGENiHBG050184.
InParanoidiQ920A7.
KOiK08956.
OMAiDTRTSFK.
OrthoDBiEOG091G03EQ.
PhylomeDBiQ920A7.
TreeFamiTF105004.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
HAMAPiMF_01458. FtsH. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR005936. FtsH.
IPR027417. P-loop_NTPase.
IPR011546. Pept_M41_FtsH_extracell.
IPR000642. Peptidase_M41.
[Graphical view]
PfamiPF00004. AAA. 1 hit.
PF06480. FtsH_ext. 1 hit.
PF01434. Peptidase_M41. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR01241. FtsH_fam. 1 hit.
PROSITEiPS00674. AAA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q920A7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLRLVGAAG SRALAWPFSK LWRCGGCAGS GGTVWSSVRA CGIALQGHLG
60 70 80 90 100
RCSQQLALQG KLTSFSPRLY SKPPRGFEKF FKNKKNRKSA SPGNSVPPKK
110 120 130 140 150
EPKNAGPGGD GGNRGGKGDD FPWWKRMQKG EFPWDDKDFR SLAVLGAGVA
160 170 180 190 200
AGFLYFYFRD PGKEITWKHF VQYYLARGLV DRLEVVNKQF VRVIPVPGTT
210 220 230 240 250
SERFVWFNIG SVDTFERNLE SAQWELGIEP TNQAAVVYTT ESDGSFLRSL
260 270 280 290 300
VPTLVLVSIL LYAMRRGPMG TGRGGRGGGL FSVGETTAKI LKNNIDVRFA
310 320 330 340 350
DVAGCEEAKL EIMEFVNFLK NPKQYQDLGA KIPKGAMLTG PPGTGKTLLA
360 370 380 390 400
KATAGEANVP FITVNGSEFL EMFVGVGPAR VRDMFAMARK HAPCILFIDE
410 420 430 440 450
IDAIGRKRGR GHLGGQSEQE NTLNQMLVEM DGFNSSTNVV VLAGTNRPDI
460 470 480 490 500
LDPALTRPGR FDRQIYIGPP DIKGRSSIFK VHLRPLKLDG SLSKDALSRK
510 520 530 540 550
LAALTPGFTG ADISNVCNEA ALIAARHLSP SVQERHFEQA IERVIGGLEK
560 570 580 590 600
KTQVLQPSEK TTVAYHEAGH AVVGWFLEHA DPLLKVSIIP RGKGLGYAQY
610 620 630 640 650
LPREQFLYTR EQLFDRMCMM LGGRVAEQLF FGQITTGAQD DLRKVTQSAY
660 670 680 690 700
AQIVQFGMSE KLGQVSFDFP RQGETMVEKP YSEATAQLID EEVRCLVRSA
710 720 730 740 750
YNRTLELLTQ CREQVEKVGR RLLEKEVLEK ADMIELLGPR PFAEKSTYEE
760 770 780
FVEGTGSLEE DTSLPEGLKD WNKGREEGGT ERGLQESPV
Length:789
Mass (Da):87,047
Last modified:February 26, 2008 - v2
Checksum:i06B23E0176285346
GO
Isoform 2 (identifier: Q920A7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     548-584: LEKKTQVLQPSEKTTVAYHEAGHAVVGWFLEHADPLL → VHHTSRQGAWLRPVPSPRAVPLHTRAALRPHVYDAGG
     585-789: Missing.

Note: No experimental confirmation available.
Show »
Length:584
Mass (Da):63,639
Checksum:i92B8935E7A9FDAD9
GO

Sequence cautioni

The sequence AAK66971 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB28211 differs from that shown. Reason: Frameshift at position 599.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_031809548 – 584LEKKT…ADPLL → VHHTSRQGAWLRPVPSPRAV PLHTRAALRPHVYDAGG in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_031810585 – 789Missing in isoform 2. 1 PublicationAdd BLAST205

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK012394 mRNA. Translation: BAB28211.3. Frameshift.
AK159647 mRNA. Translation: BAE35259.1.
AK167964 mRNA. Translation: BAE39961.1.
AK168244 mRNA. Translation: BAE40194.1.
BC056978 mRNA. Translation: AAH56978.1.
AF329695 mRNA. Translation: AAK66971.1. Different initiation.
CCDSiCCDS22760.1. [Q920A7-1]
RefSeqiNP_473411.2. NM_054070.3. [Q920A7-1]
XP_011246578.1. XM_011248276.2.
UniGeneiMm.287475.

Genome annotation databases

EnsembliENSMUST00000001520; ENSMUSP00000001520; ENSMUSG00000031967. [Q920A7-1]
ENSMUST00000098320; ENSMUSP00000095924; ENSMUSG00000031967. [Q920A7-2]
GeneIDi114896.
KEGGimmu:114896.
UCSCiuc009nwd.2. mouse. [Q920A7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK012394 mRNA. Translation: BAB28211.3. Frameshift.
AK159647 mRNA. Translation: BAE35259.1.
AK167964 mRNA. Translation: BAE39961.1.
AK168244 mRNA. Translation: BAE40194.1.
BC056978 mRNA. Translation: AAH56978.1.
AF329695 mRNA. Translation: AAK66971.1. Different initiation.
CCDSiCCDS22760.1. [Q920A7-1]
RefSeqiNP_473411.2. NM_054070.3. [Q920A7-1]
XP_011246578.1. XM_011248276.2.
UniGeneiMm.287475.

3D structure databases

ProteinModelPortaliQ920A7.
SMRiQ920A7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ920A7. 1 interactor.
MINTiMINT-1605207.
STRINGi10090.ENSMUSP00000001520.

Protein family/group databases

MEROPSiM41.016.

PTM databases

iPTMnetiQ920A7.
PhosphoSitePlusiQ920A7.

Proteomic databases

EPDiQ920A7.
PaxDbiQ920A7.
PeptideAtlasiQ920A7.
PRIDEiQ920A7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000001520; ENSMUSP00000001520; ENSMUSG00000031967. [Q920A7-1]
ENSMUST00000098320; ENSMUSP00000095924; ENSMUSG00000031967. [Q920A7-2]
GeneIDi114896.
KEGGimmu:114896.
UCSCiuc009nwd.2. mouse. [Q920A7-1]

Organism-specific databases

CTDi114896.
MGIiMGI:1928277. Afg3l1.

Phylogenomic databases

eggNOGiKOG0731. Eukaryota.
COG0465. LUCA.
GeneTreeiENSGT00860000133808.
HOGENOMiHOG000217277.
HOVERGENiHBG050184.
InParanoidiQ920A7.
KOiK08956.
OMAiDTRTSFK.
OrthoDBiEOG091G03EQ.
PhylomeDBiQ920A7.
TreeFamiTF105004.

Miscellaneous databases

PROiQ920A7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031967.
CleanExiMM_AFG3L1.
GenevisibleiQ920A7. MM.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
HAMAPiMF_01458. FtsH. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR003959. ATPase_AAA_core.
IPR003960. ATPase_AAA_CS.
IPR005936. FtsH.
IPR027417. P-loop_NTPase.
IPR011546. Pept_M41_FtsH_extracell.
IPR000642. Peptidase_M41.
[Graphical view]
PfamiPF00004. AAA. 1 hit.
PF06480. FtsH_ext. 1 hit.
PF01434. Peptidase_M41. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR01241. FtsH_fam. 1 hit.
PROSITEiPS00674. AAA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAFG31_MOUSE
AccessioniPrimary (citable) accession number: Q920A7
Secondary accession number(s): Q3THK2, Q6PGJ7, Q9CZN2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 16, 2002
Last sequence update: February 26, 2008
Last modified: November 30, 2016
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

The orthologous human gene is a pseudogene.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.