Q92035 (ACES_BUNFA) Reviewed, UniProtKB/Swiss-Prot
Last modified
October 19, 2011.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Acetylcholinesterase Short name=AChE EC=3.1.1.7 | ||
| Gene names |
| ||
| Organism | Bungarus fasciatus (Banded krait) | ||
| Taxonomic identifier | 8613 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Lepidosauria › Squamata › Scleroglossa › Serpentes › Colubroidea › Elapidae › Bungarinae › Bungarus |
Protein attributes
| Sequence length | 606 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | In muscle, it terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft. In liver, its function is unclear: it could serve as a safeguard against any diffusion of acetylcholine from synapses into the circulation. In venom, its toxic role is unclear: It could result in less musculatory control by rapidly hydrolyzing acetylcholine, or that it works synergistically with alkaline phosphatase (ALP) in paralyzing prey through hypotension. |
| Catalytic activity | Acetylcholine + H2O = choline + acetate. |
| Subunit structure | Isoform S is monomeric. Isoform T can form oligomers, including collagen-tailed forms. Ref.2 |
| Subcellular location | Cell junction › synapse. Secreted. Cell membrane; Peripheral membrane protein By similarity. |
| Tissue specificity | Liver and muscle contain both isoform T and isoform S. Venom gland predominantly contains isoform S. Ref.2 |
| Post-translational modification | The N-terminus is blocked. |
| Sequence similarities | Belongs to the type-B carboxylesterase/lipase family. |
| Caution | It is uncertain whether Met-1 or Met-9 is the initiator. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Neurotransmitter degradation |
| Cellular component | Cell junction Cell membrane Membrane Secreted Synapse |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Hydrolase Serine esterase Toxin |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | acetylcholine catabolic process in synaptic cleft Inferred from electronic annotation. Source: InterPro |
| Cellular component | cell junction Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | acetylcholinesterase activity Inferred from electronic annotation. Source: EC carboxylesterase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform T (identifier: Q92035-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform S (identifier: Q92035-1) The sequence of this isoform differs from the canonical sequence as follows: 567-606: DNIEEAERQWKLEFHLWSAYMMHWKSQFDHYNKQDRCSEL → VDPPRADRRRRSARA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | Potential | ||||||||
| Chain | 29 – 606 | 578 | Acetylcholinesterase | PRO_0000008592 | |||||||
Sites | |||||||||||
| Active site | 231 | 1 | Acyl-ester intermediate By similarity | ||||||||
| Active site | 358 | 1 | Charge relay system By similarity | ||||||||
| Active site | 471 | 1 | Charge relay system By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 289 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 374 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 484 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 564 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 98 ↔ 125 | By similarity | |||||||||
| Disulfide bond | 285 ↔ 296 | By similarity | |||||||||
| Disulfide bond | 433 ↔ 552 | By similarity | |||||||||
| Disulfide bond | 603 | Interchain; in isoform T By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 567 – 606 | 40 | DNIEE…RCSEL → VDPPRADRRRRSARA in isoform S. | VSP_008215 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 101 | 1 | M → Y: Increases peripheral site ligand binding. | ||||||||
| Mutagenesis | 316 | 1 | K → D: Increases peripheral site ligand binding. | ||||||||
| Sequence conflict | 268 | 1 | T → S AA sequence Ref.3 | ||||||||
| Sequence conflict | 350 | 1 | V → L AA sequence Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Cloning and expression of acetylcholinesterase from Bungarus fasciatus venom. A new type of COOH-terminal domain; involvement of a positively charged residue in the peripheral site." Cousin X., Bon S., Duval N., Massoulie J., Bon C. J. Biol. Chem. 271:15099-15108(1996) [PubMed: 8662867] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM S). Tissue: Venom gland. |
| [2] | "Identification of a novel type of alternatively spliced exon from the acetylcholinesterase gene of Bungarus fasciatus. Molecular forms of acetylcholinesterase in the snake liver and muscle." Cousin X., Bon S., Massoulie J., Bon C. J. Biol. Chem. 273:9812-9820(1998) [PubMed: 9545320] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 512-606 (ISOFORMS S AND T), SUBUNIT, TISSUE SPECIFICITY. Tissue: Liver and Muscle. |
| [3] | "Acetylcholinesterase from Bungarus venom: a monomeric species." Cousin X., Creminon C., Grassi J., Meflah K., Cornu G., Saliou B., Bon S., Massoulie J., Bon C. FEBS Lett. 387:196-200(1996) [PubMed: 8674549] [Abstract] Cited for: PROTEIN SEQUENCE OF 206-220; 253-272; 321-340; 347-372 AND 503-511. Tissue: Venom. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U54591 mRNA. Translation: AAC59905.1. AF045238 Genomic DNA. Translation: AAC16420.1. AF045238 Genomic DNA. Translation: AAC16421.1. |
3D structure databases | |
| ProteinModelPortal | Q92035. |
| SMR | Q92035. Positions 36-600. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | S09.979. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG008839. |
Family and domain databases | |
| InterPro | IPR014788. AChE_tetra. IPR000908. Acylcholinesterase_fish/snake. IPR002018. CarbesteraseB. IPR019826. Carboxylesterase_B_AS. IPR019819. Carboxylesterase_B_CS. IPR000997. Cholinesterase. [Graphical view] |
| Pfam | PF08674. AChE_tetra. 1 hit. PF00135. COesterase. 1 hit. [Graphical view] |
| PRINTS | PR00879. ACHEFISH. PR00878. CHOLNESTRASE. |
| ProDom | PD415333. AChE_tetra. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| PROSITE | PS00122. CARBOXYLESTERASE_B_1. 1 hit. PS00941. CARBOXYLESTERASE_B_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | ACES_BUNFA | ||||||||
| Accession | Primary (citable) accession number: Q92035 Secondary accession number(s): O73748, Q10720 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Animal Toxin Annotation Program | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with