Reviewed,
UniProtKB/Swiss-Prot Q91ZX6 (SENP2_MOUSE)
Last modified
February 9, 2010.
Version 81.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Sentrin-specific protease 2 EC=3.4.22.- Alternative name(s): Sentrin/SUMO-specific protease SENP2 SUMO-1/Smt3-specific isopeptidase 2 Short name=Smt3ip2 Axam2 SUMO-1 protease 1 Short name=SuPr-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 588 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. May down-regulate CTNNB1 levels and thereby modulate the Wnt pathway By similarity. Isoform 3 activates transcription. Ref.1 Ref.2 |
| Subunit structure | Binds to SUMO2 and SUMO3. Interacts with the C-terminal domain of NUP153 via its N-terminus By similarity. |
| Subcellular location | Isoform 1: Nucleus › nuclear pore complex. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side By similarity Ref.2. Isoform 2: Cytoplasm. Cytoplasmic vesicle. Note: Found in the cytoplasm and in cytoplasmic vesicles, together with axin. Ref.2 Isoform 3: Nucleus. Note: Found in the PML nuclear bodies. Ref.2 |
| Tissue specificity | Highly expressed in testis. Detected in brain, heart and thymus. Ref.2 |
| Domain | The N-terminus is necessary and sufficient for nuclear envelope targeting By similarity. |
| Post-translational modification | Polyubiquitinated; which leads to proteasomal degradation By similarity. |
| Sequence similarities | Belongs to the peptidase C48 family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q91ZX6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q91ZX6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MYRWLAKVLGTILRLCERPAPGARALLKRRRSSSTLFSTAVDTDEIPAKRPRL → MEQNSK | ||||||
| Note: Found in the cytoplasm and in cytoplasmic vesicles, together with axin. Ref.2 No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q91ZX6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. | ||||||
| Note: Found in the PML nuclear bodies. Ref.2 |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 588 | 588 | Sentrin-specific protease 2 | PRO_0000101719 | |||||
Regions | |||||||||
| Region | 394 – 558 | 165 | Protease | ||||||
| Motif | 28 – 31 | 4 | Nuclear localization signal Potential | ||||||
| Motif | 47 – 52 | 6 | Nuclear localization signal Potential | ||||||
| Motif | 316 – 331 | 16 | Nuclear export signal By similarity | ||||||
Sites | |||||||||
| Active site | 477 | 1 | By similarity | ||||||
| Active site | 494 | 1 | By similarity | ||||||
| Active site | 547 | 1 | Nucleophile | ||||||
Amino acid modifications | |||||||||
| Modified residue | 217 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 332 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 81 | 81 | Missing in isoform 3. | VSP_021942 | |||||
| Alternative sequence | 1 – 53 | 53 | MYRWL…KRPRL → MEQNSK in isoform 2. | VSP_005273 | |||||
Experimental info | |||||||||
| Mutagenesis | 547 | 1 | C → A: Abolishes protease activity. Ref.1 Ref.2 | ||||||
| Sequence conflict | 220 | 1 | L → F in AAL14437. Ref.1 | ||||||
| Sequence conflict | 255 | 1 | W → C in AAL14437. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of a novel mammalian SUMO-1/Smt3-specific isopeptidase, a homologue of rat Axam, which is an Axin-binding protein promoting beta-Catenin degradation." Nishida T., Kaneko F., Kitagawa M., Yasuda H. J. Biol. Chem. 276:39060-39066(2001) [PubMed: 11489887] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, MUTAGENESIS OF CYS-547. Tissue: Osteoblast. |
| [2] | "SUMO-1 protease-1 regulates gene transcription through PML." Best J.L., Ganiatsas S., Agarwal S., Changou A., Salomoni P., Shirihai O., Meluh P.B., Pandolfi P.P., Zon L.I. Mol. Cell 10:843-855(2002) [PubMed: 12419228] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), MUTAGENESIS OF CYS-547, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, FUNCTION. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Testis and Thymus. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Mammary tumor. |
| [5] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 342-348 AND 489-499, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF368904 mRNA. Translation: AAL14437.1. AY188288 mRNA. Translation: AAO27902.1. AK015987 mRNA. Translation: BAB30067.1. AK031030 mRNA. Translation: BAC27222.1. BC031652 mRNA. Translation: AAH31652.1. |
| IPI | IPI00138091. IPI00230049. IPI00817049. |
| RefSeq | NP_083733.1. |
| UniGene | Mm.297431 |
3D structure databases | |
| SMR | Q91ZX6. Positions 363-588. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q91ZX6. |
Protein family/group databases | |
| MEROPS | C48.007. |
PTM databases | |
| PhosphoSite | Q91ZX6. |
Proteomic databases | |
| PRIDE | Q91ZX6. |
Genome annotation databases | |
| Ensembl | ENSMUST00000023561; ENSMUSP00000023561; ENSMUSG00000022855; Mus musculus. [Genome view] ENSMUST00000115380; ENSMUSP00000111038; ENSMUSG00000022855; Mus musculus. [Genome view] |
| GeneID | 75826. |
| KEGG | mmu:75826. |
| UCSC | uc007yrw.1. mouse. uc007yrx.1. mouse. |
Organism-specific databases | |
| CTD | 75826. |
| MGI | MGI:1923076. Senp2. |
Phylogenomic databases | |
| eggNOG | roNOG06700. |
| HOGENOM | HBG506560. |
| HOVERGEN | Q91ZX6. |
| InParanoid | Q91ZX6. |
| OMA | IDLRKKC. |
| OrthoDB | EOG9SR0GC. |
| PhylomeDB | Q91ZX6. |
Gene expression databases | |
| ArrayExpress | Q91ZX6. |
| Bgee | Q91ZX6. |
| CleanEx | MM_SENP2. |
| Genevestigator | Q91ZX6. |
| GermOnline | ENSMUSG00000022855. Mus musculus. |
Family and domain databases | |
| InterPro | IPR003653. Peptidase_C48. [Graphical view] |
| Pfam | PF02902. Peptidase_C48. 1 hit. [Graphical view] |
| PROSITE | PS50600. ULP_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 344054. |
| SOURCE | Search... |
Entry information
| Entry name | SENP2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q91ZX6 Secondary accession number(s): Q544T8, Q811R3, Q9D4Z0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


