Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sentrin-specific protease 2

Gene

Senp2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. May down-regulate CTNNB1 levels and thereby modulate the Wnt pathway. Deconjugates SUMO2 from MTA1 (By similarity). Plays a dynamic role in adipogenesis by desumoylating and promoting the stabilization of CEBPB (PubMed:20194620). Isoform 3 activates transcription.By similarity3 Publications

Catalytic activityi

Hydrolysis of the alpha-linked peptide bond in the sequence Gly-Gly-|-Ala-Thr-Tyr at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptide, Smt3, leading to the mature form of the protein. A second reaction involves the cleavage of an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei477 – 4771By similarity
Active sitei494 – 4941By similarity
Active sitei547 – 5471Nucleophile

GO - Molecular functioni

GO - Biological processi

  • dorsal/ventral axis specification Source: Ensembl
  • fat cell differentiation Source: UniProtKB
  • heart development Source: MGI
  • labyrinthine layer development Source: MGI
  • mRNA transport Source: UniProtKB-KW
  • negative regulation of chromatin binding Source: MGI
  • negative regulation of DNA damage response, signal transduction by p53 class mediator Source: MGI
  • negative regulation of protein binding Source: Ensembl
  • negative regulation of protein ubiquitination Source: MGI
  • negative regulation of signal transduction by p53 class mediator Source: MGI
  • positive regulation of protein phosphorylation Source: Ensembl
  • positive regulation of protein ubiquitination Source: MGI
  • positive regulation of transcription from RNA polymerase II promoter Source: MGI
  • protein destabilization Source: MGI
  • protein desumoylation Source: UniProtKB
  • protein transport Source: UniProtKB-KW
  • regulation of DNA endoreduplication Source: MGI
  • regulation of G1/S transition of mitotic cell cycle Source: MGI
  • spongiotrophoblast layer development Source: MGI
  • transcription, DNA-templated Source: UniProtKB-KW
  • trophoblast giant cell differentiation Source: MGI
  • Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Hydrolase, Protease, Thiol protease

Keywords - Biological processi

mRNA transport, Protein transport, Transcription, Transcription regulation, Translocation, Transport, Ubl conjugation pathway, Wnt signaling pathway

Enzyme and pathway databases

BRENDAi3.4.22.B71. 3474.
ReactomeiR-MMU-3065679. SUMO is proteolytically processed.

Protein family/group databases

MEROPSiC48.007.

Names & Taxonomyi

Protein namesi
Recommended name:
Sentrin-specific protease 2 (EC:3.4.22.68)
Alternative name(s):
Axam2
SUMO-1 protease 1
Short name:
SuPr-1
SUMO-1/Smt3-specific isopeptidase 2
Short name:
Smt3ip2
Sentrin/SUMO-specific protease SENP2
Gene namesi
Name:Senp2
Synonyms:Smt3ip2, Supr1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:1923076. Senp2.

Subcellular locationi

Isoform 1 :
  • Nucleusnuclear pore complex By similarity
  • Nucleus membrane By similarity; Peripheral membrane protein By similarity; Nucleoplasmic side By similarity

  • Note: Shuttles between cytoplasm and nucleus.By similarity
Isoform 2 :
  • Cytoplasm
  • Cytoplasmic vesicle

  • Note: Found in the cytoplasm and in cytoplasmic vesicles, together with axin.1 Publication
Isoform 3 :

GO - Cellular componenti

  • cytoplasm Source: MGI
  • cytoplasmic, membrane-bounded vesicle Source: UniProtKB-SubCell
  • cytoplasmic vesicle Source: MGI
  • nuclear body Source: MGI
  • nuclear membrane Source: UniProtKB-SubCell
  • nuclear pore Source: UniProtKB
  • nucleus Source: MGI
  • PML body Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi547 – 5471C → A: Abolishes protease activity. 2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 588588Sentrin-specific protease 2PRO_0000101719Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei32 – 321PhosphoserineBy similarity
Modified residuei332 – 3321PhosphoserineBy similarity
Modified residuei343 – 3431PhosphoserineBy similarity

Post-translational modificationi

Polyubiquitinated; which leads to proteasomal degradation.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ91ZX6.
PaxDbiQ91ZX6.
PeptideAtlasiQ91ZX6.
PRIDEiQ91ZX6.

PTM databases

iPTMnetiQ91ZX6.
PhosphoSiteiQ91ZX6.

Expressioni

Tissue specificityi

Highly expressed in testis. Detected in brain, heart and thymus.1 Publication

Developmental stagei

In 3T3-L1 cells, expression is transiently induced during early adipocyte differentiation (PubMed:20194620).1 Publication

Gene expression databases

BgeeiENSMUSG00000022855.
CleanExiMM_SENP2.
GenevisibleiQ91ZX6. MM.

Interactioni

Subunit structurei

Binds to SUMO2 and SUMO3. Interacts with the C-terminal domain of NUP153 via its N-terminus. Interacts with MTA1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi217772. 4 interactions.
STRINGi10090.ENSMUSP00000023561.

Structurei

3D structure databases

ProteinModelPortaliQ91ZX6.
SMRiQ91ZX6. Positions 363-588.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni394 – 558165ProteaseAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi28 – 314Nuclear localization signalSequence analysis
Motifi47 – 526Nuclear localization signalSequence analysis
Motifi316 – 33116Nuclear export signalBy similarityAdd
BLAST

Domaini

The N-terminus is necessary and sufficient for nuclear envelope targeting.By similarity

Sequence similaritiesi

Belongs to the peptidase C48 family.Curated

Phylogenomic databases

eggNOGiKOG0778. Eukaryota.
COG5160. LUCA.
GeneTreeiENSGT00530000062941.
HOGENOMiHOG000070234.
HOVERGENiHBG054228.
InParanoidiQ91ZX6.
KOiK03345.
OMAiRRGYQLE.
OrthoDBiEOG091G092N.
PhylomeDBiQ91ZX6.
TreeFamiTF316289.

Family and domain databases

InterProiIPR003653. Peptidase_C48_C.
[Graphical view]
PfamiPF02902. Peptidase_C48. 1 hit.
[Graphical view]
PROSITEiPS50600. ULP_PROTEASE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q91ZX6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYRWLAKVLG TILRLCERPA PGARALLKRR RSSSTLFSTA VDTDEIPAKR
60 70 80 90 100
PRLDCFIHQV KNSLYNAASL FGFPFQLTTK PMVSSACNGT RNVAPSGEVF
110 120 130 140 150
SNSSSCELMS SGSCSSMLKL GNKSPNGISD YPKIRVTVTR DQPRRVLPSF
160 170 180 190 200
GFTLKSEGYN RRPSGRRHSK SNPESSLTWK PQEQGVTEMI SEEGGKGVRR
210 220 230 240 250
PHCTVEEGVQ KDEREKYRKL LERLKEGAHG STFPPTVSHH SSQRIQMDTL
260 270 280 290 300
KTKGWVEEQN HGVRTTHFVP KQYRVVETRG PLCSMRSEKR YSKGKADTEK
310 320 330 340 350
VVGLRFEKEG TRGHQMEPDL SEEVSARLRL GSGSNGLLRR KISVLEIKEK
360 370 380 390 400
NFPSKEKDRR TEDLFEFTED MEKEISNALG HGPPDEILSS AFKLRITRGD
410 420 430 440 450
IQTLKNYHWL NDEVINFYMN LLVERSKKQG YPALHAFSTF FYPKLKSGGY
460 470 480 490 500
QAVKRWTKGV NLFEQELVLV PIHRKVHWSL VVMDLRKKCL KYLDSMGQKG
510 520 530 540 550
HRICEILLQY LQDESKTKRN TDLNLLEWTH YSMKPHEIPQ QLNGSDCGMF
560 570 580
TCKYADYISR DKPITFTQHQ MPLFRKKMVW EILHQQLL
Length:588
Mass (Da):67,579
Last modified:November 28, 2002 - v2
Checksum:i09B56796CA194847
GO
Isoform 2 (identifier: Q91ZX6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MYRWLAKVLGTILRLCERPAPGARALLKRRRSSSTLFSTAVDTDEIPAKRPRL → MEQNSK

Note: No experimental confirmation available.
Show »
Length:541
Mass (Da):62,276
Checksum:iF25085A3FE0E0AE9
GO
Isoform 3 (identifier: Q91ZX6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Show »
Length:507
Mass (Da):58,389
Checksum:iCB6F154A1BABF39A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti220 – 2201L → F in AAL14437 (PubMed:11489887).Curated
Sequence conflicti255 – 2551W → C in AAL14437 (PubMed:11489887).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8181Missing in isoform 3. 1 PublicationVSP_021942Add
BLAST
Alternative sequencei1 – 5353MYRWL…KRPRL → MEQNSK in isoform 2. 1 PublicationVSP_005273Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF368904 mRNA. Translation: AAL14437.1.
AY188288 mRNA. Translation: AAO27902.1.
AK015987 mRNA. Translation: BAB30067.1.
AK031030 mRNA. Translation: BAC27222.1.
BC031652 mRNA. Translation: AAH31652.1.
CCDSiCCDS28065.1. [Q91ZX6-1]
RefSeqiNP_083733.1. NM_029457.3. [Q91ZX6-1]
XP_006522753.1. XM_006522690.1. [Q91ZX6-3]
UniGeneiMm.297431.

Genome annotation databases

EnsembliENSMUST00000023561; ENSMUSP00000023561; ENSMUSG00000022855. [Q91ZX6-1]
GeneIDi75826.
KEGGimmu:75826.
UCSCiuc007yrw.2. mouse. [Q91ZX6-1]
uc007yrx.2. mouse. [Q91ZX6-2]
uc007yry.2. mouse. [Q91ZX6-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF368904 mRNA. Translation: AAL14437.1.
AY188288 mRNA. Translation: AAO27902.1.
AK015987 mRNA. Translation: BAB30067.1.
AK031030 mRNA. Translation: BAC27222.1.
BC031652 mRNA. Translation: AAH31652.1.
CCDSiCCDS28065.1. [Q91ZX6-1]
RefSeqiNP_083733.1. NM_029457.3. [Q91ZX6-1]
XP_006522753.1. XM_006522690.1. [Q91ZX6-3]
UniGeneiMm.297431.

3D structure databases

ProteinModelPortaliQ91ZX6.
SMRiQ91ZX6. Positions 363-588.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi217772. 4 interactions.
STRINGi10090.ENSMUSP00000023561.

Protein family/group databases

MEROPSiC48.007.

PTM databases

iPTMnetiQ91ZX6.
PhosphoSiteiQ91ZX6.

Proteomic databases

MaxQBiQ91ZX6.
PaxDbiQ91ZX6.
PeptideAtlasiQ91ZX6.
PRIDEiQ91ZX6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023561; ENSMUSP00000023561; ENSMUSG00000022855. [Q91ZX6-1]
GeneIDi75826.
KEGGimmu:75826.
UCSCiuc007yrw.2. mouse. [Q91ZX6-1]
uc007yrx.2. mouse. [Q91ZX6-2]
uc007yry.2. mouse. [Q91ZX6-3]

Organism-specific databases

CTDi59343.
MGIiMGI:1923076. Senp2.

Phylogenomic databases

eggNOGiKOG0778. Eukaryota.
COG5160. LUCA.
GeneTreeiENSGT00530000062941.
HOGENOMiHOG000070234.
HOVERGENiHBG054228.
InParanoidiQ91ZX6.
KOiK03345.
OMAiRRGYQLE.
OrthoDBiEOG091G092N.
PhylomeDBiQ91ZX6.
TreeFamiTF316289.

Enzyme and pathway databases

BRENDAi3.4.22.B71. 3474.
ReactomeiR-MMU-3065679. SUMO is proteolytically processed.

Miscellaneous databases

PROiQ91ZX6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022855.
CleanExiMM_SENP2.
GenevisibleiQ91ZX6. MM.

Family and domain databases

InterProiIPR003653. Peptidase_C48_C.
[Graphical view]
PfamiPF02902. Peptidase_C48. 1 hit.
[Graphical view]
PROSITEiPS50600. ULP_PROTEASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSENP2_MOUSE
AccessioniPrimary (citable) accession number: Q91ZX6
Secondary accession number(s): Q544T8, Q811R3, Q9D4Z0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: November 28, 2002
Last modified: September 7, 2016
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.