Reviewed,
UniProtKB/Swiss-Prot Q91ZU6 (BPA1_MOUSE)
Last modified
November 24, 2009.
Version 75.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Bullous pemphigoid antigen 1, isoforms 1/2/3/4 Short name=BPA Alternative name(s): Hemidesmosomal plaque protein Dystonia musculorum protein Short name=Dystonin | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 7389 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cytoskeletal linker protein. Anchors keratin-containing intermediate filaments to the inner plaque of hemidesmosomes. The proteins may self-aggregate to form filaments or a two-dimensional mesh By similarity. UniProtKB Q03001 |
| Subunit structure | Homodimer. Interacts with the neuronal intermediate filament protein, Prph By similarity. UniProtKB Q60824 |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. |
| Tissue specificity | Expressed at high levels in the heart and skeletal muscle and at low levels in the skin in the adult. Expressed in the myocardium, skeletal muscle masses, vertebrae cartilage, and epithelia of the tongue of 14.5 day embryos. Ref.1 |
| Sequence similarities | Belongs to the plakin or cytolinker family. UniProtKB Q03001 Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 2 EF-hand domains. Contains 9 plectin repeats. Contains 1 SH3 domain. Contains 27 spectrin repeats. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 Ref.1 (identifier: Q91ZU6-1) Also known as: b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 Ref.1 (identifier: Q91ZU6-2) Also known as: a; The sequence of this isoform differs from the canonical sequence as follows: 1549-3557: Missing. | ||||||
| Isoform 3 (identifier: Q91ZU6-3) The sequence of this isoform differs from the canonical sequence as follows: 7125-7130: Missing. 7170-7193: Missing. 7261-7261: K → KILHPLTRNYGKPWLANSKMSTPCKAAECPDFPVSSAE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q91ZU6-4) The sequence of this isoform differs from the canonical sequence as follows: 7170-7193: Missing. 7261-7261: K → KILHPLTRNYGKPWLANSKMSTPCKAAECPDFPVSSAE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 Ref.1 (identifier: Q91ZU8-1) Also known as: e; The sequence of this isoform can be found in the external entry Q91ZU8-1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 6 (identifier: Q60824-1) Also known as: n1; The sequence of this isoform can be found in the external entry Q60824-1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 7 (identifier: Q60824-2) Also known as: n2; The sequence of this isoform can be found in the external entry Q60824-2. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 7389 | 7389 | Bullous pemphigoid antigen 1, isoforms 1/2/3/4 | PRO_0000078141 | |||||
Regions | |||||||||
| Domain | 31 – 255 | 225 | Actin-binding | ||||||
| Domain | 35 – 138 | 104 | CH 1 | ||||||
| Domain | 151 – 252 | 102 | CH 2 | ||||||
| Repeat | 590 – 667 | 78 | Spectrin 1 | ||||||
| Repeat | 675 – 770 | 96 | Spectrin 2 | ||||||
| Domain | 889 – 941 | 53 | SH3 | ||||||
| Repeat | 1260 – 1356 | 97 | Spectrin 3 | ||||||
| Repeat | 1537 – 1581 | 45 | Plectin 1 | ||||||
| Repeat | 1582 – 1619 | 38 | Plectin 2 | ||||||
| Repeat | 1657 – 1694 | 38 | Plectin 3 | ||||||
| Repeat | 1695 – 1732 | 38 | Plectin 4 | ||||||
| Repeat | 1735 – 1770 | 36 | Plectin 5 | ||||||
| Repeat | 1771 – 1808 | 38 | Plectin 6 | ||||||
| Repeat | 1811 – 1846 | 36 | Plectin 7 | ||||||
| Repeat | 1847 – 1884 | 38 | Plectin 8 | ||||||
| Repeat | 1886 – 1922 | 37 | Plectin 9 | ||||||
| Repeat | 3814 – 3914 | 101 | Spectrin 4 | ||||||
| Repeat | 4053 – 4152 | 100 | Spectrin 5 | ||||||
| Repeat | 4270 – 4346 | 77 | Spectrin 6 | ||||||
| Repeat | 4409 – 4517 | 109 | Spectrin 7 | ||||||
| Repeat | 4522 – 4620 | 99 | Spectrin 8 | ||||||
| Repeat | 4623 – 4729 | 107 | Spectrin 9 | ||||||
| Repeat | 4742 – 4840 | 99 | Spectrin 10 | ||||||
| Repeat | 4851 – 4949 | 99 | Spectrin 11 | ||||||
| Repeat | 5177 – 5278 | 102 | Spectrin 12 | ||||||
| Repeat | 5288 – 5385 | 98 | Spectrin 13 | ||||||
| Repeat | 5397 – 5497 | 101 | Spectrin 14 | ||||||
| Repeat | 5506 – 5605 | 100 | Spectrin 15 | ||||||
| Repeat | 5646 – 5714 | 69 | Spectrin 16 | ||||||
| Repeat | 5725 – 5824 | 100 | Spectrin 17 | ||||||
| Repeat | 5946 – 6046 | 101 | Spectrin 18 | ||||||
| Repeat | 6055 – 6155 | 101 | Spectrin 19 | ||||||
| Repeat | 6165 – 6265 | 101 | Spectrin 20 | ||||||
| Repeat | 6274 – 6372 | 99 | Spectrin 21 | ||||||
| Repeat | 6383 – 6480 | 98 | Spectrin 22 | ||||||
| Repeat | 6492 – 6592 | 101 | Spectrin 23 | ||||||
| Repeat | 6602 – 6701 | 100 | Spectrin 24 | ||||||
| Repeat | 6710 – 6808 | 99 | Spectrin 25 | ||||||
| Repeat | 6826 – 6914 | 89 | Spectrin 26 | ||||||
| Repeat | 6962 – 7020 | 59 | Spectrin 27 | ||||||
| Domain | 7015 – 7050 | 36 | EF-hand 1 | ||||||
| Domain | 7051 – 7086 | 36 | EF-hand 2 | ||||||
| Calcium binding | 7028 – 7039 | 12 | 1 Potential | ||||||
| Calcium binding | 7064 – 7075 | 12 | 2 Potential | ||||||
| Coiled coil | 452 – 486 | 35 | Potential | ||||||
| Coiled coil | 638 – 703 | 66 | Potential | ||||||
| Coiled coil | 737 – 773 | 37 | Potential | ||||||
| Coiled coil | 1003 – 1138 | 136 | Potential | ||||||
| Coiled coil | 1195 – 1247 | 53 | Potential | ||||||
| Coiled coil | 1413 – 1455 | 43 | Potential | ||||||
| Coiled coil | 1504 – 1527 | 24 | Potential | ||||||
| Coiled coil | 3336 – 3359 | 24 | Potential | ||||||
| Coiled coil | 3539 – 3715 | 177 | Potential | ||||||
| Coiled coil | 3809 – 3893 | 85 | Potential | ||||||
| Coiled coil | 3957 – 3978 | 22 | Potential | ||||||
| Coiled coil | 4006 – 4043 | 38 | Potential | ||||||
| Coiled coil | 4159 – 4209 | 51 | Potential | ||||||
| Coiled coil | 4270 – 4311 | 42 | Potential | ||||||
| Coiled coil | 4426 – 4563 | 138 | Potential | ||||||
| Coiled coil | 4696 – 4735 | 40 | Potential | ||||||
| Coiled coil | 4847 – 5097 | 251 | Potential | ||||||
| Coiled coil | 5173 – 5233 | 61 | Potential | ||||||
| Coiled coil | 5570 – 5603 | 34 | Potential | ||||||
| Coiled coil | 5717 – 5739 | 23 | Potential | ||||||
| Coiled coil | 5787 – 5809 | 23 | Potential | ||||||
| Coiled coil | 6010 – 6089 | 80 | Potential | ||||||
| Coiled coil | 6116 – 6164 | 49 | Potential | ||||||
| Coiled coil | 6277 – 6318 | 42 | Potential | ||||||
| Coiled coil | 6381 – 6417 | 37 | Potential | ||||||
| Coiled coil | 6769 – 6803 | 35 | Potential | ||||||
| Coiled coil | 6976 – 7000 | 25 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 40 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 42 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 7182 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1549 – 3557 | 2009 | Missing in isoform 1. Ref.1 | VSP_050483 | |||||
| Alternative sequence | 7125 – 7130 | 6 | Missing in isoform 3. | VSP_050484 | |||||
| Alternative sequence | 7170 – 7193 | 24 | Missing in isoform 3 and isoform 4. | VSP_050485 | |||||
| Alternative sequence | 7261 | 1 | K → KILHPLTRNYGKPWLANSKM STPCKAAECPDFPVSSAE in isoform 3 and isoform 4. | VSP_050486 | |||||
Experimental info | |||||||||
| Sequence conflict | 6193 | 1 | T → A in AAK83383. Ref.1 | ||||||
| Sequence conflict | 7097 | 1 | G → E Ref.3 | ||||||
| Sequence conflict | 7241 | 1 | G → A Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The BPAG1 locus: alternative splicing produces multiple isoforms with distinct cytoskeletal linker domains, including predominant isoforms in neurons and muscles." Leung C.L., Zheng M., Prater S.M., Liem R.K.H. J. Cell Biol. 154:691-697(2001) [PubMed: 11514586] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. Strain: BALB/c. Tissue: Muscle and Neuron. |
| [2] | Lubec G., Kang S.U. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 1473-1478; 3996-4006; 5515-5522; 6904-6913 AND 7378-7385, MASS SPECTROMETRY. Strain: C57BL/6. Tissue: Brain. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6693-7389 (ISOFORMS 3 AND 4). Strain: C57BL/6J. Tissue: Fetal skin and Fetal spinal cord. |
| [4] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed: 17114649] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-7182, MASS SPECTROMETRY. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF396879 mRNA. Translation: AAK83384.1. AF396878 mRNA. Translation: AAK83383.1. AK051626 mRNA. Translation: BAC34695.1. AK037206 mRNA. Translation: BAC29753.1. | |
| IPI | IPI00230689. IPI00230690. IPI00230692. IPI00284272. |
| RefSeq | NP_598594.2. NP_604443.2. |
| UniGene | Mm.336625 |
3D structure databases | |
| SMR | Q91ZU6. Positions 28-258. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q91ZU6. |
PTM databases | |
| PhosphoSite | Q91ZU6. |
Proteomic databases | |
| PRIDE | Q91ZU6. |
Genome annotation databases | |
| Ensembl | ENSMUST00000097786; ENSMUSP00000095393; ENSMUSG00000026131; Mus musculus. [Genome view] |
| GeneID | 13518. |
| KEGG | mmu:13518. |
| UCSC | uc007aoi.1. mouse. uc007aoj.1. mouse. |
Organism-specific databases | |
| CTD | 13518. |
| MGI | MGI:104627. Dst. |
Phylogenomic databases | |
| HOGENOM | Q91ZU6. |
| HOVERGEN | Q91ZU6. |
Gene expression databases | |
| CleanEx | MM_DST. |
| Genevestigator | Q91ZU6. |
| GermOnline | ENSMUSG00000026131. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001589. Actinin_actin-bd_CS. IPR016146. Calponin-homology. IPR001715. Calponin_act_bd. IPR011992. EF-Hand_type. IPR018247. EF_Hand_1_Ca_BS. IPR018249. EF_HAND_2. IPR002048. EF_hand_Ca_bd. IPR018248. EF_Hand_dom. IPR003108. GAS2. IPR001101. Plectin_repeat. IPR018159. Spectrin/alpha-actinin. IPR002017. Spectrin_repeat. [Graphical view] |
| Gene3D | G3DSA:1.10.418.10. Calponin-homology. 2 hits. G3DSA:1.10.238.10. EF-Hand_type. 1 hit. |
| Pfam | PF00307. CH. 2 hits. PF00036. efhand. 2 hits. PF02187. GAS2. 1 hit. PF00681. Plectin. 4 hits. PF00435. Spectrin. 24 hits. [Graphical view] |
| SMART | SM00033. CH. 2 hits. SM00054. EFh. 2 hits. SM00243. GAS2. 1 hit. SM00250. PLEC. 9 hits. SM00150. SPEC. 32 hits. [Graphical view] |
| PROSITE | PS00019. ACTININ_1. 1 hit. PS00020. ACTININ_2. 1 hit. PS50021. CH. 2 hits. PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 2 hits. PS50002. SH3. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | BPA1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q91ZU6 Secondary accession number(s): Q91ZU7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


