Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q91XM9

- DLG2_MOUSE

UniProt

Q91XM9 - DLG2_MOUSE

Protein

Disks large homolog 2

Gene

Dlg2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 2 (03 Oct 2012)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses.1 Publication

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. negative regulation of phosphatase activity Source: UniProtKB
    2. sensory perception of pain Source: MGI
    3. synaptic transmission Source: MGI

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disks large homolog 2
    Alternative name(s):
    Channel-associated protein of synapse-110
    Short name:
    Chapsyn-110
    Postsynaptic density protein PSD-93
    Gene namesi
    Name:Dlg2
    Synonyms:Dlgh2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 7

    Organism-specific databases

    MGIiMGI:1344351. Dlg2.

    Subcellular locationi

    Membrane By similarity; Lipid-anchor By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse By similarity
    Note: Concentrated in soma and postsynaptic density of a subset of neurons.By similarity

    GO - Cellular componenti

    1. cell junction Source: MGI
    2. juxtaparanode region of axon Source: MGI
    3. postsynaptic density Source: UniProtKB-SubCell
    4. postsynaptic membrane Source: MGI

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Disruption phenotypei

    Mice do not respond to persistent pain. Postsynaptic surface expression of NMDA receptors and NMDA receptor-mediated synaptic function are reduced in dorsal horn neurons of the spinal chord.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 852852Disks large homolog 2PRO_0000094554Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi5 – 51S-palmitoyl cysteineBy similarity
    Lipidationi7 – 71S-palmitoyl cysteineBy similarity
    Modified residuei28 – 281Phosphoserine1 Publication
    Modified residuei58 – 581Phosphotyrosine1 Publication
    Modified residuei65 – 651Phosphoserine1 Publication
    Modified residuei414 – 4141Phosphoserine1 Publication
    Modified residuei505 – 5051Phosphotyrosine1 Publication
    Modified residuei732 – 7321Phosphotyrosine1 Publication
    Modified residuei737 – 7371Phosphotyrosine1 Publication

    Post-translational modificationi

    Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density.By similarity

    Keywords - PTMi

    Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    MaxQBiQ91XM9.
    PaxDbiQ91XM9.
    PRIDEiQ91XM9.

    PTM databases

    PhosphoSiteiQ91XM9.

    Expressioni

    Tissue specificityi

    Brain. Highest levels of isoform 1 in cortex, olfactory bulb, thalamus, hypothalamus, striatum and hippocampus. Highest level of isoform 2 in olfactory bulb. Reduced levels in cortex and hippocampus. Highest level of isoform 4 in spinal cord. Low levels of isoform 4, isoform 6, and isoform 7 in superior cervical ganglion.2 Publications

    Gene expression databases

    ArrayExpressiQ91XM9.
    CleanExiMM_DLG2.
    GenevestigatoriQ91XM9.

    Interactioni

    Subunit structurei

    Interacts with NOS1/nNOS through second PDZ domain. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains By similarity. Interacts with KCNJ4. Interacts with FRMPD4 (via C-terminus) By similarity. Interacts through its PDZ domains with Neto1. Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG By similarity. Interacts with KCNJ4 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Dlg4Q621085EBI-400138,EBI-300895

    Protein-protein interaction databases

    BioGridi204763. 3 interactions.
    DIPiDIP-31569N.
    IntActiQ91XM9. 9 interactions.
    MINTiMINT-136378.

    Structurei

    Secondary structure

    1
    852
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi95 – 1028
    Turni104 – 1063
    Beta strandi110 – 1145
    Beta strandi127 – 1326
    Helixi137 – 1415
    Beta strandi149 – 1535
    Helixi163 – 17210
    Beta strandi175 – 18410

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2WL7X-ray2.03A95-188[»]
    ProteinModelPortaliQ91XM9.
    SMRiQ91XM9. Positions 93-283, 418-852.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ91XM9.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini98 – 18588PDZ 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini193 – 28088PDZ 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini421 – 50282PDZ 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini536 – 60671SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini662 – 837176Guanylate kinase-likePROSITE-ProRule annotationAdd
    BLAST

    Domaini

    Isoform 7 has an L27 domain close to N-terminus.

    Sequence similaritiesi

    Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
    Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiCOG0194.
    GeneTreeiENSGT00660000095130.
    HOGENOMiHOG000232102.
    HOVERGENiHBG107814.
    KOiK12075.
    OrthoDBiEOG79GT6P.
    TreeFamiTF323171.

    Family and domain databases

    Gene3Di2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProiIPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR019590. MAGUK_PEST_N.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR019583. PDZ_assoc.
    IPR001452. SH3_domain.
    [Graphical view]
    PANTHERiPTHR23119. PTHR23119. 1 hit.
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF10608. MAGUK_N_PEST. 1 hit.
    PF00595. PDZ. 3 hits.
    PF10600. PDZ_assoc. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view]
    PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
    SMARTiSM00072. GuKc. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 2 hits.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q91XM9-1) [UniParc]FASTAAdd to Basket

    Also known as: PSD93-alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFFACYCALR TNVKKYRYQD EDGPHDHSLP RLTHEVRGPE LVHVSEKNLS    50
    QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT 100
    LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI 150
    LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP 200
    KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN 250
    YSLEEVTHEE AVAILKNTSD VVYLKVGKPT TIYMTDPYGP PDITHSYSPP 300
    MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLGEDDY TRPPEPVYST 350
    VNKLCDKPAS PRHYSPVECD KSFLLSTPYP HYHLGLLPDS DMTSHSQHST 400
    ATRQPSVTLQ RAISLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL 450
    AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY 500
    QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS 550
    KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVTLDGDS EEMGVIPSKR 600
    RVERKERARL KTVKFNAKPG VIDSKGDIPG LGDDGYGTKT LRGQEDLILS 650
    YEPVTRQEIN YTRPVIILGP MKDRINDDLI SEFPDKFGSC VPHTTRPKRD 700
    YEVDGRDYHF VISREQMEKD IQEHKFIEAG QYNDNLYGTS VQSVRFVAER 750
    GKHCILDVSG NAIKRLQVAQ LYPIAIFIKP KSLEPLMEMN KRLTEEQAKK 800
    TYDRAIKLEQ EFGEYFTAIV QGDTLEDIYN QCKLVIEEQS GPFIWIPSKE 850
    KL 852
    Length:852
    Mass (Da):94,880
    Last modified:October 3, 2012 - v2
    Checksum:i632914AE45ACEBB6
    GO
    Isoform 2 (identifier: Q91XM9-2) [UniParc]FASTAAdd to Basket

    Also known as: PSD93-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC

    Show »
    Length:859
    Mass (Da):95,531
    Checksum:iD3BE703AE529AC57
    GO
    Isoform 3 (identifier: Q91XM9-3) [UniParc]FASTAAdd to Basket

    Also known as: PSD93-gamma

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: Missing.
         62-68: SHISPLK → MQHAFIP

    Show »
    Length:791
    Mass (Da):87,790
    Checksum:i645487F4769B1768
    GO
    Isoform 4 (identifier: Q91XM9-4) [UniParc]FASTAAdd to Basket

    Also known as: PSD93-delta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

    Show »
    Length:887
    Mass (Da):97,928
    Checksum:i7416EAB77947D245
    GO
    Isoform 5 (identifier: Q91XM9-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ
         394-394: S → RYCMRFLTSSSPVACVSTRMDGWNSSPPTSLALSTFLVERCSASMVRWEKLRTWLFCSFCCAH
         395-852: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:491
    Mass (Da):53,570
    Checksum:i0926554D5F3A8FE6
    GO
    Isoform 6 (identifier: Q91XM9-6) [UniParc]FASTAAdd to Basket

    Also known as: PSD93 epsilon

    The sequence of this isoform differs from the canonical sequence as follows:
         1-42: Missing.
         43-67: HVSEKNLSQIENVHGYVLQSHISPL → MFASIWYAKKLGRRFVHNARKAKSE

    Show »
    Length:810
    Mass (Da):90,071
    Checksum:iE3F3ADB9E5ECA0D5
    GO
    Isoform 7 (identifier: Q91XM9-7) [UniParc]FASTAAdd to Basket

    Also known as: PSD93 zeta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-14: MFFACYCALRTNVK → MPVKKKDTDR...PTWMPVHHCT
         69-86: Missing.

    Show »
    Length:976
    Mass (Da):109,239
    Checksum:i137F926A3694DC90
    GO
    Isoform 8 (identifier: Q91XM9-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         465-503: DQILSVNGID...VTIIAQYQPE → VINASVNRTG...LPALFPNFVL

    Note: Incomplete sequence.

    Show »
    Length:852
    Mass (Da):95,055
    Checksum:iED0E8A1613E89FF5
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti107 – 1071G → S in BAC32772. (PubMed:16141072)Curated
    Sequence conflicti123 – 1231D → G in AAK64496. 1 PublicationCurated
    Sequence conflicti213 – 2131N → D in AAK64496. 1 PublicationCurated
    Sequence conflicti301 – 3011M → T in AAK64496. 1 PublicationCurated
    Sequence conflicti323 – 3231S → P in AAK64496. 1 PublicationCurated
    Sequence conflicti585 – 5851T → I in AAK64496. 1 PublicationCurated
    Sequence conflicti776 – 7761I → T in AAK64496. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6868MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDI GRSAPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4 and isoform 5. 1 PublicationVSP_012869Add
    BLAST
    Alternative sequencei1 – 6161Missing in isoform 3. CuratedVSP_015517Add
    BLAST
    Alternative sequencei1 – 4242Missing in isoform 6. CuratedVSP_015518Add
    BLAST
    Alternative sequencei1 – 1414MFFAC…RTNVK → MPVKKKDTDRALSLLEEYCK KLRKPEEQLLKNAVKKVMSI FKSSLFQALLDIQEFYEVTL LNSQKSCEQKIEEANHVAQK WEKTLLLDSCRDSLQKSSEH ASCSGPKENALYIEQNKENQ CSENETEEKTCQNQGKCPAQ NCSVEAPTWMPVHHCT in isoform 7. CuratedVSP_015519Add
    BLAST
    Alternative sequencei1 – 1313MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2. CuratedVSP_015520Add
    BLAST
    Alternative sequencei43 – 6725HVSEK…HISPL → MFASIWYAKKLGRRFVHNAR KAKSE in isoform 6. CuratedVSP_015521Add
    BLAST
    Alternative sequencei62 – 687SHISPLK → MQHAFIP in isoform 3. CuratedVSP_015522
    Alternative sequencei69 – 8618Missing in isoform 7. CuratedVSP_015523Add
    BLAST
    Alternative sequencei394 – 3941S → RYCMRFLTSSSPVACVSTRM DGWNSSPPTSLALSTFLVER CSASMVRWEKLRTWLFCSFC CAH in isoform 5. 1 PublicationVSP_012870
    Alternative sequencei395 – 852458Missing in isoform 5. 1 PublicationVSP_012871Add
    BLAST
    Alternative sequencei465 – 50339DQILS…QYQPE → VINASVNRTGDRRIWHQGNG KAASSVSCLLPALFPNFVL in isoform 8. 1 PublicationVSP_015524Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF388675 mRNA. Translation: AAK64496.1.
    AK046525 mRNA. Translation: BAC32772.1.
    AK039754 mRNA. Translation: BAC30440.1.
    AC100322 Genomic DNA. No translation available.
    AC101784 Genomic DNA. No translation available.
    AC108818 Genomic DNA. No translation available.
    AC108832 Genomic DNA. No translation available.
    AC109506 Genomic DNA. No translation available.
    AC112262 Genomic DNA. No translation available.
    AC118621 Genomic DNA. No translation available.
    AC119218 Genomic DNA. No translation available.
    AC121261 Genomic DNA. No translation available.
    AC122002 Genomic DNA. No translation available.
    AC127299 Genomic DNA. No translation available.
    AC127683 Genomic DNA. No translation available.
    AC140196 Genomic DNA. No translation available.
    AC141890 Genomic DNA. No translation available.
    AC161490 Genomic DNA. No translation available.
    AC162304 Genomic DNA. No translation available.
    CCDSiCCDS40021.1. [Q91XM9-1]
    RefSeqiNP_001229976.1. NM_001243047.1.
    NP_035937.2. NM_011807.3. [Q91XM9-1]
    UniGeneiMm.147213.
    Mm.257035.

    Genome annotation databases

    EnsembliENSMUST00000107196; ENSMUSP00000102814; ENSMUSG00000052572. [Q91XM9-1]
    GeneIDi23859.
    KEGGimmu:23859.
    UCSCiuc009ihs.1. mouse. [Q91XM9-5]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF388675 mRNA. Translation: AAK64496.1 .
    AK046525 mRNA. Translation: BAC32772.1 .
    AK039754 mRNA. Translation: BAC30440.1 .
    AC100322 Genomic DNA. No translation available.
    AC101784 Genomic DNA. No translation available.
    AC108818 Genomic DNA. No translation available.
    AC108832 Genomic DNA. No translation available.
    AC109506 Genomic DNA. No translation available.
    AC112262 Genomic DNA. No translation available.
    AC118621 Genomic DNA. No translation available.
    AC119218 Genomic DNA. No translation available.
    AC121261 Genomic DNA. No translation available.
    AC122002 Genomic DNA. No translation available.
    AC127299 Genomic DNA. No translation available.
    AC127683 Genomic DNA. No translation available.
    AC140196 Genomic DNA. No translation available.
    AC141890 Genomic DNA. No translation available.
    AC161490 Genomic DNA. No translation available.
    AC162304 Genomic DNA. No translation available.
    CCDSi CCDS40021.1. [Q91XM9-1 ]
    RefSeqi NP_001229976.1. NM_001243047.1.
    NP_035937.2. NM_011807.3. [Q91XM9-1 ]
    UniGenei Mm.147213.
    Mm.257035.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2WL7 X-ray 2.03 A 95-188 [» ]
    ProteinModelPortali Q91XM9.
    SMRi Q91XM9. Positions 93-283, 418-852.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204763. 3 interactions.
    DIPi DIP-31569N.
    IntActi Q91XM9. 9 interactions.
    MINTi MINT-136378.

    PTM databases

    PhosphoSitei Q91XM9.

    Proteomic databases

    MaxQBi Q91XM9.
    PaxDbi Q91XM9.
    PRIDEi Q91XM9.

    Protocols and materials databases

    DNASUi 23859.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000107196 ; ENSMUSP00000102814 ; ENSMUSG00000052572 . [Q91XM9-1 ]
    GeneIDi 23859.
    KEGGi mmu:23859.
    UCSCi uc009ihs.1. mouse. [Q91XM9-5 ]

    Organism-specific databases

    CTDi 1740.
    MGIi MGI:1344351. Dlg2.

    Phylogenomic databases

    eggNOGi COG0194.
    GeneTreei ENSGT00660000095130.
    HOGENOMi HOG000232102.
    HOVERGENi HBG107814.
    KOi K12075.
    OrthoDBi EOG79GT6P.
    TreeFami TF323171.

    Miscellaneous databases

    ChiTaRSi DLG2. mouse.
    EvolutionaryTracei Q91XM9.
    NextBioi 303569.
    PROi Q91XM9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q91XM9.
    CleanExi MM_DLG2.
    Genevestigatori Q91XM9.

    Family and domain databases

    Gene3Di 2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProi IPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR019590. MAGUK_PEST_N.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR019583. PDZ_assoc.
    IPR001452. SH3_domain.
    [Graphical view ]
    PANTHERi PTHR23119. PTHR23119. 1 hit.
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF10608. MAGUK_N_PEST. 1 hit.
    PF00595. PDZ. 3 hits.
    PF10600. PDZ_assoc. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF001741. MAGUK_DLGH. 1 hit.
    SMARTi SM00072. GuKc. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 2 hits.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and sequencing of mouse PSD-93 cDNA."
      Yamashita T., Mochizuki C., Miyagi Y., Sonoda T., Kawamoto S.
      Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: BALB/c.
      Tissue: Cerebellum.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 465-852 (ISOFORM 8).
      Strain: C57BL/6J.
      Tissue: Adrenal gland and Spinal cord.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "Inward rectifier K+ channel Kir2.3 is localized at the postsynaptic membrane of excitatory synapses."
      Inanobe A., Fujita A., Ito M., Tomoike H., Inageda K., Kurachi Y.
      Am. J. Physiol. 282:C1396-C1403(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KCNJ4.
    5. "Impaired NMDA receptor-mediated postsynaptic function and blunted NMDA receptor-dependent persistent pain in mice lacking postsynaptic density-93 protein."
      Tao Y.-X., Rumbaugh G., Wang G.-D., Petralia R.S., Zhao C., Kauer F.W., Tao F., Zhuo M., Wenthold R.J., Raja S.N., Huganir R.L., Bredt D.S., Johns R.A.
      J. Neurosci. 23:6703-6712(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
    6. "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1."
      Leyland M.L., Dart C.
      J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    7. "PSD93 regulates synaptic stability at neuronal cholinergic synapses."
      Parker M.J., Zhao S., Bredt D.S., Sanes J.R., Feng G.
      J. Neurosci. 24:378-388(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING.
    8. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28 AND SER-414, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    9. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
      Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
      J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-58; SER-65; TYR-505; TYR-732 AND TYR-737, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    10. "Neto1 is a novel CUB-domain NMDA receptor-interacting protein required for synaptic plasticity and learning."
      Ng D., Pitcher G.M., Szilard R.K., Sertie A., Kanisek M., Clapcote S.J., Lipina T., Kalia L.V., Joo D., McKerlie C., Cortez M., Roder J.C., Salter M.W., McInnes R.R.
      PLoS Biol. 7:E41-E41(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NETO1.
    11. Cited for: X-RAY CRYSTALLOGRAPHY (2.03 ANGSTROMS) OF 95-188.

    Entry informationi

    Entry nameiDLG2_MOUSE
    AccessioniPrimary (citable) accession number: Q91XM9
    Secondary accession number(s): F8VQM7, Q8BXK7, Q8BYG5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 15, 2005
    Last sequence update: October 3, 2012
    Last modified: October 1, 2014
    This is version 115 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3