Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q91XM9 (DLG2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 114. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name=Chapsyn-110
Postsynaptic density protein PSD-93
Gene names
Name:Dlg2
Synonyms:Dlgh2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length852 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses. Ref.5

Subunit structure

Interacts with NOS1/nNOS through second PDZ domain. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains By similarity. Interacts with KCNJ4. Interacts with FRMPD4 (via C-terminus) By similarity. Interacts through its PDZ domains with Neto1. Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG By similarity. Interacts with KCNJ4 By similarity. Ref.4 Ref.10

Subcellular location

Membrane; Lipid-anchor By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse By similarity. Note: Concentrated in soma and postsynaptic density of a subset of neurons By similarity.

Tissue specificity

Brain. Highest levels of isoform 1 in cortex, olfactory bulb, thalamus, hypothalamus, striatum and hippocampus. Highest level of isoform 2 in olfactory bulb. Reduced levels in cortex and hippocampus. Highest level of isoform 4 in spinal cord. Low levels of isoform 4, isoform 6, and isoform 7 in superior cervical ganglion. Ref.5 Ref.6

Domain

Isoform 7 has an L27 domain close to N-terminus.

Post-translational modification

Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density By similarity.

Disruption phenotype

Mice do not respond to persistent pain. Postsynaptic surface expression of NMDA receptors and NMDA receptor-mediated synaptic function are reduced in dorsal horn neurons of the spinal chord. Ref.5

Sequence similarities

Contains 1 guanylate kinase-like domain.

Contains 3 PDZ (DHR) domains.

Contains 1 SH3 domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

Dlg4Q621085EBI-400138,EBI-300895

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q91XM9-1)

Also known as: PSD93-alpha;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q91XM9-2)

Also known as: PSD93-beta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC
Isoform 3 (identifier: Q91XM9-3)

Also known as: PSD93-gamma;

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     62-68: SHISPLK → MQHAFIP
Isoform 4 (identifier: Q91XM9-4)

Also known as: PSD93-delta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ
Isoform 5 (identifier: Q91XM9-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ
     394-394: S → RYCMRFLTSSSPVACVSTRMDGWNSSPPTSLALSTFLVERCSASMVRWEKLRTWLFCSFCCAH
     395-852: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q91XM9-6)

Also known as: PSD93 epsilon;

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.
     43-67: HVSEKNLSQIENVHGYVLQSHISPL → MFASIWYAKKLGRRFVHNARKAKSE
Isoform 7 (identifier: Q91XM9-7)

Also known as: PSD93 zeta;

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MPVKKKDTDR...PTWMPVHHCT
     69-86: Missing.
Isoform 8 (identifier: Q91XM9-8)

The sequence of this isoform differs from the canonical sequence as follows:
     465-503: DQILSVNGID...VTIIAQYQPE → VINASVNRTG...LPALFPNFVL
Note: Incomplete sequence.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 852852Disks large homolog 2
PRO_0000094554

Regions

Domain98 – 18588PDZ 1
Domain193 – 28088PDZ 2
Domain421 – 50282PDZ 3
Domain536 – 60671SH3
Domain662 – 837176Guanylate kinase-like

Amino acid modifications

Modified residue281Phosphoserine Ref.8
Modified residue581Phosphotyrosine Ref.9
Modified residue651Phosphoserine Ref.9
Modified residue4141Phosphoserine Ref.8
Modified residue5051Phosphotyrosine Ref.9
Modified residue7321Phosphotyrosine Ref.9
Modified residue7371Phosphotyrosine Ref.9
Lipidation51S-palmitoyl cysteine By similarity
Lipidation71S-palmitoyl cysteine By similarity

Natural variations

Alternative sequence1 – 6868MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDI GRSAPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4 and isoform 5.
VSP_012869
Alternative sequence1 – 6161Missing in isoform 3.
VSP_015517
Alternative sequence1 – 4242Missing in isoform 6.
VSP_015518
Alternative sequence1 – 1414MFFAC…RTNVK → MPVKKKDTDRALSLLEEYCK KLRKPEEQLLKNAVKKVMSI FKSSLFQALLDIQEFYEVTL LNSQKSCEQKIEEANHVAQK WEKTLLLDSCRDSLQKSSEH ASCSGPKENALYIEQNKENQ CSENETEEKTCQNQGKCPAQ NCSVEAPTWMPVHHCT in isoform 7.
VSP_015519
Alternative sequence1 – 1313MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2.
VSP_015520
Alternative sequence43 – 6725HVSEK…HISPL → MFASIWYAKKLGRRFVHNAR KAKSE in isoform 6.
VSP_015521
Alternative sequence62 – 687SHISPLK → MQHAFIP in isoform 3.
VSP_015522
Alternative sequence69 – 8618Missing in isoform 7.
VSP_015523
Alternative sequence3941S → RYCMRFLTSSSPVACVSTRM DGWNSSPPTSLALSTFLVER CSASMVRWEKLRTWLFCSFC CAH in isoform 5.
VSP_012870
Alternative sequence395 – 852458Missing in isoform 5.
VSP_012871
Alternative sequence465 – 50339DQILS…QYQPE → VINASVNRTGDRRIWHQGNG KAASSVSCLLPALFPNFVL in isoform 8.
VSP_015524

Experimental info

Sequence conflict1071G → S in BAC32772. Ref.2
Sequence conflict1231D → G in AAK64496. Ref.1
Sequence conflict2131N → D in AAK64496. Ref.1
Sequence conflict3011M → T in AAK64496. Ref.1
Sequence conflict3231S → P in AAK64496. Ref.1
Sequence conflict5851T → I in AAK64496. Ref.1
Sequence conflict7761I → T in AAK64496. Ref.1

Secondary structure

................. 852
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (PSD93-alpha) [UniParc].

Last modified October 3, 2012. Version 2.
Checksum: 632914AE45ACEBB6

FASTA85294,880
        10         20         30         40         50         60 
MFFACYCALR TNVKKYRYQD EDGPHDHSLP RLTHEVRGPE LVHVSEKNLS QIENVHGYVL 

        70         80         90        100        110        120 
QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT LERGNSGLGF SIAGGTDNPH 

       130        140        150        160        170        180 
IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY 

       190        200        210        220        230        240 
VRRRRPILET VVEIKLFKGP KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ 

       250        260        270        280        290        300 
VGDRLLMVNN YSLEEVTHEE AVAILKNTSD VVYLKVGKPT TIYMTDPYGP PDITHSYSPP 

       310        320        330        340        350        360 
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLGEDDY TRPPEPVYST VNKLCDKPAS 

       370        380        390        400        410        420 
PRHYSPVECD KSFLLSTPYP HYHLGLLPDS DMTSHSQHST ATRQPSVTLQ RAISLEGEPR 

       430        440        450        460        470        480 
KVVLHKGSTG LGFNIVGGED GEGIFVSFIL AGGPADLSGE LQRGDQILSV NGIDLRGASH 

       490        500        510        520        530        540 
EQAAAALKGA GQTVTIIAQY QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY 

       550        560        570        580        590        600 
VRAMFDYDKS KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVTLDGDS EEMGVIPSKR 

       610        620        630        640        650        660 
RVERKERARL KTVKFNAKPG VIDSKGDIPG LGDDGYGTKT LRGQEDLILS YEPVTRQEIN 

       670        680        690        700        710        720 
YTRPVIILGP MKDRINDDLI SEFPDKFGSC VPHTTRPKRD YEVDGRDYHF VISREQMEKD 

       730        740        750        760        770        780 
IQEHKFIEAG QYNDNLYGTS VQSVRFVAER GKHCILDVSG NAIKRLQVAQ LYPIAIFIKP 

       790        800        810        820        830        840 
KSLEPLMEMN KRLTEEQAKK TYDRAIKLEQ EFGEYFTAIV QGDTLEDIYN QCKLVIEEQS 

       850 
GPFIWIPSKE KL 

« Hide

Isoform 2 (PSD93-beta) [UniParc].

Checksum: D3BE703AE529AC57
Show »

FASTA85995,531
Isoform 3 (PSD93-gamma) [UniParc].

Checksum: 645487F4769B1768
Show »

FASTA79187,790
Isoform 4 (PSD93-delta) [UniParc].

Checksum: 7416EAB77947D245
Show »

FASTA88797,928
Isoform 5 [UniParc].

Checksum: 0926554D5F3A8FE6
Show »

FASTA49153,570
Isoform 6 (PSD93 epsilon) [UniParc].

Checksum: E3F3ADB9E5ECA0D5
Show »

FASTA81090,071
Isoform 7 (PSD93 zeta) [UniParc].

Checksum: 137F926A3694DC90
Show »

FASTA976109,239
Isoform 8 [UniParc].

Checksum: ED0E8A1613E89FF5
Show »

FASTA85295,055

References

« Hide 'large scale' references
[1]"Cloning and sequencing of mouse PSD-93 cDNA."
Yamashita T., Mochizuki C., Miyagi Y., Sonoda T., Kawamoto S.
Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: BALB/c.
Tissue: Cerebellum.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 465-852 (ISOFORM 8).
Strain: C57BL/6J.
Tissue: Adrenal gland and Spinal cord.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"Inward rectifier K+ channel Kir2.3 is localized at the postsynaptic membrane of excitatory synapses."
Inanobe A., Fujita A., Ito M., Tomoike H., Inageda K., Kurachi Y.
Am. J. Physiol. 282:C1396-C1403(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH KCNJ4.
[5]"Impaired NMDA receptor-mediated postsynaptic function and blunted NMDA receptor-dependent persistent pain in mice lacking postsynaptic density-93 protein."
Tao Y.-X., Rumbaugh G., Wang G.-D., Petralia R.S., Zhao C., Kauer F.W., Tao F., Zhuo M., Wenthold R.J., Raja S.N., Huganir R.L., Bredt D.S., Johns R.A.
J. Neurosci. 23:6703-6712(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
[6]"An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1."
Leyland M.L., Dart C.
J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[7]"PSD93 regulates synaptic stability at neuronal cholinergic synapses."
Parker M.J., Zhao S., Bredt D.S., Sanes J.R., Feng G.
J. Neurosci. 24:378-388(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING.
[8]"Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28 AND SER-414, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
[9]"Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-58; SER-65; TYR-505; TYR-732 AND TYR-737, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
[10]"Neto1 is a novel CUB-domain NMDA receptor-interacting protein required for synaptic plasticity and learning."
Ng D., Pitcher G.M., Szilard R.K., Sertie A., Kanisek M., Clapcote S.J., Lipina T., Kalia L.V., Joo D., McKerlie C., Cortez M., Roder J.C., Salter M.W., McInnes R.R.
PLoS Biol. 7:E41-E41(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH NETO1.
[11]"Structure of the first PDZ domain of human PSD-93."
Fiorentini M., Nielsen A.K., Kristensen O., Kastrup J.S., Gajhede M.
Acta Crystallogr. F 65:1254-1257(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.03 ANGSTROMS) OF 95-188.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF388675 mRNA. Translation: AAK64496.1.
AK046525 mRNA. Translation: BAC32772.1.
AK039754 mRNA. Translation: BAC30440.1.
AC100322 Genomic DNA. No translation available.
AC101784 Genomic DNA. No translation available.
AC108818 Genomic DNA. No translation available.
AC108832 Genomic DNA. No translation available.
AC109506 Genomic DNA. No translation available.
AC112262 Genomic DNA. No translation available.
AC118621 Genomic DNA. No translation available.
AC119218 Genomic DNA. No translation available.
AC121261 Genomic DNA. No translation available.
AC122002 Genomic DNA. No translation available.
AC127299 Genomic DNA. No translation available.
AC127683 Genomic DNA. No translation available.
AC140196 Genomic DNA. No translation available.
AC141890 Genomic DNA. No translation available.
AC161490 Genomic DNA. No translation available.
AC162304 Genomic DNA. No translation available.
CCDSCCDS40021.1. [Q91XM9-1]
RefSeqNP_001229976.1. NM_001243047.1.
NP_035937.2. NM_011807.3. [Q91XM9-1]
UniGeneMm.147213.
Mm.257035.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2WL7X-ray2.03A95-188[»]
ProteinModelPortalQ91XM9.
SMRQ91XM9. Positions 93-283, 418-852.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid204763. 3 interactions.
DIPDIP-31569N.
IntActQ91XM9. 9 interactions.
MINTMINT-136378.

PTM databases

PhosphoSiteQ91XM9.

Proteomic databases

MaxQBQ91XM9.
PaxDbQ91XM9.
PRIDEQ91XM9.

Protocols and materials databases

DNASU23859.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000107196; ENSMUSP00000102814; ENSMUSG00000052572. [Q91XM9-1]
GeneID23859.
KEGGmmu:23859.
UCSCuc009ihs.1. mouse. [Q91XM9-5]

Organism-specific databases

CTD1740.
MGIMGI:1344351. Dlg2.

Phylogenomic databases

eggNOGCOG0194.
GeneTreeENSGT00660000095130.
HOGENOMHOG000232102.
HOVERGENHBG107814.
KOK12075.
OrthoDBEOG79GT6P.
TreeFamTF323171.

Gene expression databases

ArrayExpressQ91XM9.
CleanExMM_DLG2.
GenevestigatorQ91XM9.

Family and domain databases

Gene3D2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProIPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view]
PANTHERPTHR23119. PTHR23119. 1 hit.
PfamPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PIRSFPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTSM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSDLG2. mouse.
EvolutionaryTraceQ91XM9.
NextBio303569.
PROQ91XM9.
SOURCESearch...

Entry information

Entry nameDLG2_MOUSE
AccessionPrimary (citable) accession number: Q91XM9
Secondary accession number(s): F8VQM7, Q8BXK7, Q8BYG5
Entry history
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: October 3, 2012
Last modified: July 9, 2014
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot