Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 2

Gene

Dlg2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses.1 Publication

GO - Molecular functioni

GO - Biological processi

  • chemical synaptic transmission Source: MGI
  • negative regulation of phosphatase activity Source: UniProtKB
  • nervous system development Source: GO_Central
  • receptor clustering Source: GO_Central
  • receptor localization to synapse Source: GO_Central
  • sensory perception of pain Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-6794361. Interactions of neurexins and neuroligins at synapses.

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-110
Postsynaptic density protein PSD-93
Gene namesi
Name:Dlg2
Synonyms:Dlgh2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1344351. Dlg2.

Subcellular locationi

  • Cell membrane 1 Publication; Lipid-anchor By similarity
  • Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity
  • Cell junctionsynapse By similarity
  • Membrane By similarity
  • Cell projectionaxon By similarity

  • Note: Concentrated in soma and postsynaptic density of a subset of neurons.By similarity

GO - Cellular componenti

  • cell junction Source: MGI
  • juxtaparanode region of axon Source: MGI
  • postsynaptic density Source: MGI
  • postsynaptic membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

Mice do not respond to persistent pain. Postsynaptic surface expression of NMDA receptors and NMDA receptor-mediated synaptic function are reduced in dorsal horn neurons of the spinal chord.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945541 – 852Disks large homolog 2Add BLAST852

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi5S-palmitoyl cysteineBy similarity1
Lipidationi7S-palmitoyl cysteineBy similarity1
Modified residuei28PhosphoserineCombined sources1
Modified residuei58PhosphotyrosineCombined sources1
Modified residuei65PhosphoserineCombined sources1
Modified residuei307PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei360PhosphoserineBy similarity1
Modified residuei365PhosphoserineCombined sources1
Modified residuei406PhosphoserineBy similarity1
Modified residuei414PhosphoserineCombined sources1
Modified residuei505PhosphotyrosineCombined sources1
Modified residuei528PhosphoserineBy similarity1
Modified residuei530PhosphoserineBy similarity1
Modified residuei553PhosphoserineCombined sources1
Modified residuei732PhosphotyrosineCombined sources1
Modified residuei737PhosphotyrosineCombined sources1

Post-translational modificationi

Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiQ91XM9.
PeptideAtlasiQ91XM9.
PRIDEiQ91XM9.

PTM databases

iPTMnetiQ91XM9.
PhosphoSitePlusiQ91XM9.
SwissPalmiQ91XM9.

Expressioni

Tissue specificityi

Brain. Highest levels of isoform 1 in cortex, olfactory bulb, thalamus, hypothalamus, striatum and hippocampus. Highest level of isoform 2 in olfactory bulb. Reduced levels in cortex and hippocampus. Highest level of isoform 4 in spinal cord. Low levels of isoform 4, isoform 6, and isoform 7 in superior cervical ganglion.2 Publications

Gene expression databases

BgeeiENSMUSG00000052572.
CleanExiMM_DLG2.
ExpressionAtlasiQ91XM9. baseline and differential.
GenevisibleiQ91XM9. MM.

Interactioni

Subunit structurei

Interacts with NOS1/nNOS through second PDZ domain. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains (By similarity). Interacts with KCNJ4 (PubMed:11997254). Interacts with FRMPD4 (via C-terminus) (By similarity). Interacts through its PDZ domains with NETO1 (PubMed:19243221). Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG (By similarity). Interacts with KCNJ4 (By similarity). Interacts with ADAM22 (PubMed:20089912).By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Dlg4Q621085EBI-400138,EBI-300895

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204763. 3 interactors.
DIPiDIP-31569N.
IntActiQ91XM9. 9 interactors.
MINTiMINT-136378.
STRINGi10090.ENSMUSP00000102814.

Structurei

Secondary structure

1852
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi95 – 102Combined sources8
Turni104 – 106Combined sources3
Beta strandi110 – 114Combined sources5
Beta strandi127 – 132Combined sources6
Helixi137 – 141Combined sources5
Beta strandi149 – 153Combined sources5
Helixi163 – 172Combined sources10
Beta strandi175 – 184Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WL7X-ray2.03A95-188[»]
ProteinModelPortaliQ91XM9.
SMRiQ91XM9.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ91XM9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini98 – 185PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini193 – 280PDZ 2PROSITE-ProRule annotationAdd BLAST88
Domaini421 – 502PDZ 3PROSITE-ProRule annotationAdd BLAST82
Domaini536 – 606SH3PROSITE-ProRule annotationAdd BLAST71
Domaini662 – 837Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Domaini

Isoform 7 has an L27 domain close to N-terminus.

Sequence similaritiesi

Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ91XM9.
KOiK12075.
TreeFamiTF323171.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 2 hits.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q91XM9-1) [UniParc]FASTAAdd to basket
Also known as: PSD93-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFFACYCALR TNVKKYRYQD EDGPHDHSLP RLTHEVRGPE LVHVSEKNLS
60 70 80 90 100
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT
110 120 130 140 150
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI
160 170 180 190 200
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP
210 220 230 240 250
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN
260 270 280 290 300
YSLEEVTHEE AVAILKNTSD VVYLKVGKPT TIYMTDPYGP PDITHSYSPP
310 320 330 340 350
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLGEDDY TRPPEPVYST
360 370 380 390 400
VNKLCDKPAS PRHYSPVECD KSFLLSTPYP HYHLGLLPDS DMTSHSQHST
410 420 430 440 450
ATRQPSVTLQ RAISLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL
460 470 480 490 500
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY
510 520 530 540 550
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS
560 570 580 590 600
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVTLDGDS EEMGVIPSKR
610 620 630 640 650
RVERKERARL KTVKFNAKPG VIDSKGDIPG LGDDGYGTKT LRGQEDLILS
660 670 680 690 700
YEPVTRQEIN YTRPVIILGP MKDRINDDLI SEFPDKFGSC VPHTTRPKRD
710 720 730 740 750
YEVDGRDYHF VISREQMEKD IQEHKFIEAG QYNDNLYGTS VQSVRFVAER
760 770 780 790 800
GKHCILDVSG NAIKRLQVAQ LYPIAIFIKP KSLEPLMEMN KRLTEEQAKK
810 820 830 840 850
TYDRAIKLEQ EFGEYFTAIV QGDTLEDIYN QCKLVIEEQS GPFIWIPSKE

KL
Length:852
Mass (Da):94,880
Last modified:October 3, 2012 - v2
Checksum:i632914AE45ACEBB6
GO
Isoform 2 (identifier: Q91XM9-2) [UniParc]FASTAAdd to basket
Also known as: PSD93-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC

Show »
Length:859
Mass (Da):95,531
Checksum:iD3BE703AE529AC57
GO
Isoform 3 (identifier: Q91XM9-3) [UniParc]FASTAAdd to basket
Also known as: PSD93-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     62-68: SHISPLK → MQHAFIP

Show »
Length:791
Mass (Da):87,790
Checksum:i645487F4769B1768
GO
Isoform 4 (identifier: Q91XM9-4) [UniParc]FASTAAdd to basket
Also known as: PSD93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:887
Mass (Da):97,928
Checksum:i7416EAB77947D245
GO
Isoform 5 (identifier: Q91XM9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ
     394-394: S → RYCMRFLTSSSPVACVSTRMDGWNSSPPTSLALSTFLVERCSASMVRWEKLRTWLFCSFCCAH
     395-852: Missing.

Note: No experimental confirmation available.
Show »
Length:491
Mass (Da):53,570
Checksum:i0926554D5F3A8FE6
GO
Isoform 6 (identifier: Q91XM9-6) [UniParc]FASTAAdd to basket
Also known as: PSD93 epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.
     43-67: HVSEKNLSQIENVHGYVLQSHISPL → MFASIWYAKKLGRRFVHNARKAKSE

Show »
Length:810
Mass (Da):90,071
Checksum:iE3F3ADB9E5ECA0D5
GO
Isoform 7 (identifier: Q91XM9-7) [UniParc]FASTAAdd to basket
Also known as: PSD93 zeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MPVKKKDTDR...PTWMPVHHCT
     69-86: Missing.

Show »
Length:976
Mass (Da):109,239
Checksum:i137F926A3694DC90
GO
Isoform 8 (identifier: Q91XM9-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     465-503: DQILSVNGID...VTIIAQYQPE → VINASVNRTG...LPALFPNFVL

Note: Incomplete sequence.
Show »
Length:852
Mass (Da):95,055
Checksum:iED0E8A1613E89FF5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti107G → S in BAC32772 (PubMed:16141072).Curated1
Sequence conflicti123D → G in AAK64496 (Ref. 1) Curated1
Sequence conflicti213N → D in AAK64496 (Ref. 1) Curated1
Sequence conflicti301M → T in AAK64496 (Ref. 1) Curated1
Sequence conflicti323S → P in AAK64496 (Ref. 1) Curated1
Sequence conflicti585T → I in AAK64496 (Ref. 1) Curated1
Sequence conflicti776I → T in AAK64496 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0128691 – 68MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDI GRSAPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4 and isoform 5. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0155171 – 61Missing in isoform 3. CuratedAdd BLAST61
Alternative sequenceiVSP_0155181 – 42Missing in isoform 6. CuratedAdd BLAST42
Alternative sequenceiVSP_0155191 – 14MFFAC…RTNVK → MPVKKKDTDRALSLLEEYCK KLRKPEEQLLKNAVKKVMSI FKSSLFQALLDIQEFYEVTL LNSQKSCEQKIEEANHVAQK WEKTLLLDSCRDSLQKSSEH ASCSGPKENALYIEQNKENQ CSENETEEKTCQNQGKCPAQ NCSVEAPTWMPVHHCT in isoform 7. CuratedAdd BLAST14
Alternative sequenceiVSP_0155201 – 13MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2. CuratedAdd BLAST13
Alternative sequenceiVSP_01552143 – 67HVSEK…HISPL → MFASIWYAKKLGRRFVHNAR KAKSE in isoform 6. CuratedAdd BLAST25
Alternative sequenceiVSP_01552262 – 68SHISPLK → MQHAFIP in isoform 3. Curated7
Alternative sequenceiVSP_01552369 – 86Missing in isoform 7. CuratedAdd BLAST18
Alternative sequenceiVSP_012870394S → RYCMRFLTSSSPVACVSTRM DGWNSSPPTSLALSTFLVER CSASMVRWEKLRTWLFCSFC CAH in isoform 5. 1 Publication1
Alternative sequenceiVSP_012871395 – 852Missing in isoform 5. 1 PublicationAdd BLAST458
Alternative sequenceiVSP_015524465 – 503DQILS…QYQPE → VINASVNRTGDRRIWHQGNG KAASSVSCLLPALFPNFVL in isoform 8. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388675 mRNA. Translation: AAK64496.1.
AK046525 mRNA. Translation: BAC32772.1.
AK039754 mRNA. Translation: BAC30440.1.
AC100322 Genomic DNA. No translation available.
AC101784 Genomic DNA. No translation available.
AC108818 Genomic DNA. No translation available.
AC108832 Genomic DNA. No translation available.
AC109506 Genomic DNA. No translation available.
AC112262 Genomic DNA. No translation available.
AC118621 Genomic DNA. No translation available.
AC119218 Genomic DNA. No translation available.
AC121261 Genomic DNA. No translation available.
AC122002 Genomic DNA. No translation available.
AC127299 Genomic DNA. No translation available.
AC127683 Genomic DNA. No translation available.
AC140196 Genomic DNA. No translation available.
AC141890 Genomic DNA. No translation available.
AC161490 Genomic DNA. No translation available.
AC162304 Genomic DNA. No translation available.
CCDSiCCDS40021.1. [Q91XM9-1]
RefSeqiNP_001229976.1. NM_001243047.1.
NP_035937.2. NM_011807.3. [Q91XM9-1]
UniGeneiMm.147213.
Mm.257035.

Genome annotation databases

EnsembliENSMUST00000107196; ENSMUSP00000102814; ENSMUSG00000052572. [Q91XM9-1]
GeneIDi23859.
KEGGimmu:23859.
UCSCiuc009ihr.2. mouse. [Q91XM9-1]
uc009ihs.1. mouse. [Q91XM9-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF388675 mRNA. Translation: AAK64496.1.
AK046525 mRNA. Translation: BAC32772.1.
AK039754 mRNA. Translation: BAC30440.1.
AC100322 Genomic DNA. No translation available.
AC101784 Genomic DNA. No translation available.
AC108818 Genomic DNA. No translation available.
AC108832 Genomic DNA. No translation available.
AC109506 Genomic DNA. No translation available.
AC112262 Genomic DNA. No translation available.
AC118621 Genomic DNA. No translation available.
AC119218 Genomic DNA. No translation available.
AC121261 Genomic DNA. No translation available.
AC122002 Genomic DNA. No translation available.
AC127299 Genomic DNA. No translation available.
AC127683 Genomic DNA. No translation available.
AC140196 Genomic DNA. No translation available.
AC141890 Genomic DNA. No translation available.
AC161490 Genomic DNA. No translation available.
AC162304 Genomic DNA. No translation available.
CCDSiCCDS40021.1. [Q91XM9-1]
RefSeqiNP_001229976.1. NM_001243047.1.
NP_035937.2. NM_011807.3. [Q91XM9-1]
UniGeneiMm.147213.
Mm.257035.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WL7X-ray2.03A95-188[»]
ProteinModelPortaliQ91XM9.
SMRiQ91XM9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204763. 3 interactors.
DIPiDIP-31569N.
IntActiQ91XM9. 9 interactors.
MINTiMINT-136378.
STRINGi10090.ENSMUSP00000102814.

PTM databases

iPTMnetiQ91XM9.
PhosphoSitePlusiQ91XM9.
SwissPalmiQ91XM9.

Proteomic databases

PaxDbiQ91XM9.
PeptideAtlasiQ91XM9.
PRIDEiQ91XM9.

Protocols and materials databases

DNASUi23859.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000107196; ENSMUSP00000102814; ENSMUSG00000052572. [Q91XM9-1]
GeneIDi23859.
KEGGimmu:23859.
UCSCiuc009ihr.2. mouse. [Q91XM9-1]
uc009ihs.1. mouse. [Q91XM9-5]

Organism-specific databases

CTDi1740.
MGIiMGI:1344351. Dlg2.

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ91XM9.
KOiK12075.
TreeFamiTF323171.

Enzyme and pathway databases

ReactomeiR-MMU-6794361. Interactions of neurexins and neuroligins at synapses.

Miscellaneous databases

ChiTaRSiDlg2. mouse.
EvolutionaryTraceiQ91XM9.
PROiQ91XM9.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000052572.
CleanExiMM_DLG2.
ExpressionAtlasiQ91XM9. baseline and differential.
GenevisibleiQ91XM9. MM.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 2 hits.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDLG2_MOUSE
AccessioniPrimary (citable) accession number: Q91XM9
Secondary accession number(s): F8VQM7, Q8BXK7, Q8BYG5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: October 3, 2012
Last modified: November 2, 2016
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.