Q91XM9 (DLG2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large homolog 2 Alternative name(s): Channel-associated protein of synapse-110 Short name=Chapsyn-110 Postsynaptic density protein PSD-93 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 852 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses. Ref.4 |
| Subunit structure | Interacts with NOS1/nNOS through second PDZ domain. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains By similarity. Interacts with FRMPD4 (via C-terminus) By similarity. Interacts through its PDZ domains with Neto1. Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG By similarity. Ref.11 |
| Subcellular location | Membrane; Lipid-anchor By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Cell junction › synapse By similarity. Note: Concentrated in soma and postsynaptic density of a subset of neurons By similarity. |
| Tissue specificity | Brain. Highest levels of isoform 1 in cortex, olfactory bulb, thalamus, hypothalamus, striatum and hippocampus. Highest level of isoform 2 in olfactory bulb. Reduced levels in cortex and hippocampus. Highest level of isoform 4 in spinal cord. Low levels of isoform 4, isoform 6, and isoform 7 in superior cervical ganglion. Ref.4 Ref.5 |
| Domain | Isoform 7 has an L27 domain close to N-terminus. |
| Post-translational modification | Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density By similarity. |
| Disruption phenotype | Mice do not respond to persistent pain. Postsynaptic surface expression of NMDA receptors and NMDA receptor-mediated synaptic function are reduced in dorsal horn neurons of the spinal chord. Ref.4 |
| Sequence similarities | Contains 1 guanylate kinase-like domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cell membrane Membrane Postsynaptic cell membrane Synapse |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat SH3 domain |
| PTM | Lipoprotein Palmitate Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | negative regulation of phosphatase activity Inferred from sequence or structural similarity. Source: UniProtKB sensory perception of painInferred from mutant phenotype Ref.4. Source: MGI synaptic transmissionInferred from mutant phenotype Ref.4. Source: MGI |
| Cellular_component | cell junction Inferred from direct assay PubMed 21920314. Source: MGI juxtaparanode region of axonInferred from direct assay PubMed 19109503. Source: MGI plasma membraneInferred from electronic annotation. Source: UniProtKB-KW postsynaptic densityInferred from electronic annotation. Source: UniProtKB-SubCell postsynaptic membraneInferred from direct assay Ref.4. Source: MGI |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Dlg4 | Q62108 | 5 | EBI-400138,EBI-300895 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q91XM9-1) Also known as: PSD93-alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q91XM9-2) Also known as: PSD93-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC | ||||||
| Isoform 3 (identifier: Q91XM9-3) Also known as: PSD93-gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-61: Missing. 62-68: SHISPLK → MQHAFIP | ||||||
| Isoform 4 (identifier: Q91XM9-4) Also known as: PSD93-delta; The sequence of this isoform differs from the canonical sequence as follows: 1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ | ||||||
| Isoform 5 (identifier: Q91XM9-5) The sequence of this isoform differs from the canonical sequence as follows: 1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ 394-394: S → RYCMRFLTSSSPVACVSTRMDGWNSSPPTSLALSTFLVERCSASMVRWEKLRTWLFCSFCCAH 395-852: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q91XM9-6) Also known as: PSD93 epsilon; The sequence of this isoform differs from the canonical sequence as follows: 1-42: Missing. 43-67: HVSEKNLSQIENVHGYVLQSHISPL → MFASIWYAKKLGRRFVHNARKAKSE | ||||||
| Isoform 7 (identifier: Q91XM9-7) Also known as: PSD93 zeta; The sequence of this isoform differs from the canonical sequence as follows: 1-14: MFFACYCALRTNVK → MPVKKKDTDR...PTWMPVHHCT 69-86: Missing. | ||||||
| Isoform 8 (identifier: Q91XM9-8) The sequence of this isoform differs from the canonical sequence as follows: 465-503: DQILSVNGID...VTIIAQYQPE → VINASVNRTG...LPALFPNFVL | ||||||
| Note: Incomplete sequence. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 852 | 852 | Disks large homolog 2 | PRO_0000094554 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Domain | 98 – 185 | 88 | PDZ 1 | ||||||||||||||||||||||
| Domain | 193 – 280 | 88 | PDZ 2 | ||||||||||||||||||||||
| Domain | 421 – 502 | 82 | PDZ 3 | ||||||||||||||||||||||
| Domain | 536 – 606 | 71 | SH3 | ||||||||||||||||||||||
| Domain | 662 – 837 | 176 | Guanylate kinase-like | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Modified residue | 28 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||
| Modified residue | 58 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||
| Modified residue | 62 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||
| Modified residue | 175 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||
| Modified residue | 340 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||
| Modified residue | 348 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||
| Modified residue | 365 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||
| Modified residue | 406 | 1 | Phosphoserine Ref.10 | ||||||||||||||||||||||
| Modified residue | 414 | 1 | Phosphoserine Ref.7 Ref.8 Ref.10 | ||||||||||||||||||||||
| Modified residue | 500 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||
| Modified residue | 505 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||
| Modified residue | 732 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||
| Modified residue | 737 | 1 | Phosphotyrosine Ref.9 | ||||||||||||||||||||||
| Lipidation | 5 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||||||||||||
| Lipidation | 7 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 1 – 68 | 68 | MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDI GRSAPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4 and isoform 5. | VSP_012869 | |||||||||||||||||||||
| Alternative sequence | 1 – 61 | 61 | Missing in isoform 3. | VSP_015517 | |||||||||||||||||||||
| Alternative sequence | 1 – 42 | 42 | Missing in isoform 6. | VSP_015518 | |||||||||||||||||||||
| Alternative sequence | 1 – 14 | 14 | MFFAC…RTNVK → MPVKKKDTDRALSLLEEYCK KLRKPEEQLLKNAVKKVMSI FKSSLFQALLDIQEFYEVTL LNSQKSCEQKIEEANHVAQK WEKTLLLDSCRDSLQKSSEH ASCSGPKENALYIEQNKENQ CSENETEEKTCQNQGKCPAQ NCSVEAPTWMPVHHCT in isoform 7. | VSP_015519 | |||||||||||||||||||||
| Alternative sequence | 1 – 13 | 13 | MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2. | VSP_015520 | |||||||||||||||||||||
| Alternative sequence | 43 – 67 | 25 | HVSEK…HISPL → MFASIWYAKKLGRRFVHNAR KAKSE in isoform 6. | VSP_015521 | |||||||||||||||||||||
| Alternative sequence | 62 – 68 | 7 | SHISPLK → MQHAFIP in isoform 3. | VSP_015522 | |||||||||||||||||||||
| Alternative sequence | 69 – 86 | 18 | Missing in isoform 7. | VSP_015523 | |||||||||||||||||||||
| Alternative sequence | 394 | 1 | S → RYCMRFLTSSSPVACVSTRM DGWNSSPPTSLALSTFLVER CSASMVRWEKLRTWLFCSFC CAH in isoform 5. | VSP_012870 | |||||||||||||||||||||
| Alternative sequence | 395 – 852 | 458 | Missing in isoform 5. | VSP_012871 | |||||||||||||||||||||
| Alternative sequence | 465 – 503 | 39 | DQILS…QYQPE → VINASVNRTGDRRIWHQGNG KAASSVSCLLPALFPNFVL in isoform 8. | VSP_015524 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Sequence conflict | 107 | 1 | G → S in BAC32772. Ref.2 | ||||||||||||||||||||||
| Sequence conflict | 123 | 1 | D → G in AAK64496. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 213 | 1 | N → D in AAK64496. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 301 | 1 | M → T in AAK64496. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 323 | 1 | S → P in AAK64496. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 585 | 1 | T → I in AAK64496. Ref.1 | ||||||||||||||||||||||
| Sequence conflict | 776 | 1 | I → T in AAK64496. Ref.1 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Beta strand | 95 – 102 | 8 | |||||||||||||||||||||||
| Turn | 104 – 106 | 3 | |||||||||||||||||||||||
| Beta strand | 110 – 114 | 5 | |||||||||||||||||||||||
| Beta strand | 127 – 132 | 6 | |||||||||||||||||||||||
| Helix | 137 – 141 | 5 | |||||||||||||||||||||||
| Beta strand | 149 – 153 | 5 | |||||||||||||||||||||||
| Helix | 163 – 172 | 10 | |||||||||||||||||||||||
| Beta strand | 175 – 184 | 10 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and sequencing of mouse PSD-93 cDNA." Yamashita T., Mochizuki C., Miyagi Y., Sonoda T., Kawamoto S. Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: BALB/c. Tissue: Cerebellum. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 465-852 (ISOFORM 8). Strain: C57BL/6J. Tissue: Adrenal gland and Spinal cord. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "Impaired NMDA receptor-mediated postsynaptic function and blunted NMDA receptor-dependent persistent pain in mice lacking postsynaptic density-93 protein." Tao Y.-X., Rumbaugh G., Wang G.-D., Petralia R.S., Zhao C., Kauer F.W., Tao F., Zhuo M., Wenthold R.J., Raja S.N., Huganir R.L., Bredt D.S., Johns R.A. J. Neurosci. 23:6703-6712(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [5] | "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1." Leyland M.L., Dart C. J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [6] | "PSD93 regulates synaptic stability at neuronal cholinergic synapses." Parker M.J., Zhao S., Bredt D.S., Sanes J.R., Feng G. J. Neurosci. 24:378-388(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [7] | "Proteomic analysis of in vivo phosphorylated synaptic proteins." Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I., Blackstock W.P., Choudhary J.S., Grant S.G. J. Biol. Chem. 280:5972-5982(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-414, MASS SPECTROMETRY. Tissue: Forebrain. |
| [8] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28; SER-175; SER-365 AND SER-414, MASS SPECTROMETRY. Tissue: Brain. |
| [9] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-58; SER-62; TYR-340; TYR-348; TYR-500; TYR-505; TYR-732 AND TYR-737, MASS SPECTROMETRY. Tissue: Brain. |
| [10] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406 AND SER-414, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [11] | "Neto1 is a novel CUB-domain NMDA receptor-interacting protein required for synaptic plasticity and learning." Ng D., Pitcher G.M., Szilard R.K., Sertie A., Kanisek M., Clapcote S.J., Lipina T., Kalia L.V., Joo D., McKerlie C., Cortez M., Roder J.C., Salter M.W., McInnes R.R. PLoS Biol. 7:E41-E41(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NETO1. |
| [12] | "Structure of the first PDZ domain of human PSD-93." Fiorentini M., Nielsen A.K., Kristensen O., Kastrup J.S., Gajhede M. Acta Crystallogr. F 65:1254-1257(2009) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.03 ANGSTROMS) OF 95-188. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF388675 mRNA. Translation: AAK64496.1. AK046525 mRNA. Translation: BAC32772.1. AK039754 mRNA. Translation: BAC30440.1. AC100322 Genomic DNA. No translation available. AC101784 Genomic DNA. No translation available. AC108818 Genomic DNA. No translation available. AC108832 Genomic DNA. No translation available. AC109506 Genomic DNA. No translation available. AC112262 Genomic DNA. No translation available. AC118621 Genomic DNA. No translation available. AC119218 Genomic DNA. No translation available. AC121261 Genomic DNA. No translation available. AC122002 Genomic DNA. No translation available. AC127299 Genomic DNA. No translation available. AC127683 Genomic DNA. No translation available. AC140196 Genomic DNA. No translation available. AC141890 Genomic DNA. No translation available. AC161490 Genomic DNA. No translation available. AC162304 Genomic DNA. No translation available. | ||||||||||||
| IPI | IPI00129282. IPI00226727. IPI00466988. IPI00648194. IPI00648424. IPI00649556. IPI00649990. IPI01026606. | ||||||||||||
| RefSeq | NP_001229976.1. NM_001243047.1. NP_035937.2. NM_011807.3. | ||||||||||||
| UniGene | Mm.147213. Mm.257035. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q91XM9. | ||||||||||||
| SMR | Q91XM9. Positions 93-283, 418-849. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-31569N. | ||||||||||||
| IntAct | Q91XM9. 4 interactions. | ||||||||||||
| MINT | MINT-136378. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q91XM9. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q91XM9. | ||||||||||||
| PRIDE | Q91XM9. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 23859. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000107196; ENSMUSP00000102814; ENSMUSG00000052572. | ||||||||||||
| GeneID | 23859. | ||||||||||||
| KEGG | mmu:23859. | ||||||||||||
| UCSC | uc009ihr.2. mouse. uc009ihs.1. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1740. | ||||||||||||
| MGI | MGI:1344351. Dlg2. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0194. | ||||||||||||
| GeneTree | ENSGT00660000095130. | ||||||||||||
| HOGENOM | HOG000232102. | ||||||||||||
| HOVERGEN | HBG107814. | ||||||||||||
| KO | K12075. | ||||||||||||
| OrthoDB | EOG447FSN. | ||||||||||||
Gene expression databases | |||||||||||||
| CleanEx | MM_DLG2. | ||||||||||||
| Genevestigator | Q91XM9. | ||||||||||||
| GermOnline | ENSMUSG00000052572. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR020590. Guanylate_kinase_CS. IPR016313. M-assoc_guanylate_kinase. IPR019590. MAGUK_PEST_N. IPR027417. P-loop_NTPase. IPR001478. PDZ. IPR019583. PDZ_assoc. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF10608. MAGUK_N_PEST. 1 hit. PF00595. PDZ. 3 hits. PF10600. PDZ_assoc. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF001741. MAGUK_DLGH. 1 hit. | ||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 3 hits. SSF50044. SH3. 1 hit. SSF52540. SSF52540. 1 hit. | ||||||||||||
| PROSITE | PS00856. GUANYLATE_KINASE_1. 1 hit. PS50052. GUANYLATE_KINASE_2. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | DLG2. mouse. | ||||||||||||
| EvolutionaryTrace | Q91XM9. | ||||||||||||
| NextBio | 303569. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | DLG2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q91XM9 Secondary accession number(s): F8VQM7, Q8BXK7, Q8BYG5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
