Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q91XM9

- DLG2_MOUSE

UniProt

Q91XM9 - DLG2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Disks large homolog 2

Gene

Dlg2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses.1 Publication

GO - Biological processi

  1. negative regulation of phosphatase activity Source: UniProtKB
  2. sensory perception of pain Source: MGI
  3. synaptic transmission Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-110
Postsynaptic density protein PSD-93
Gene namesi
Name:Dlg2
Synonyms:Dlgh2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 7

Organism-specific databases

MGIiMGI:1344351. Dlg2.

Subcellular locationi

Membrane By similarity; Lipid-anchor By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse By similarity
Note: Concentrated in soma and postsynaptic density of a subset of neurons.By similarity

GO - Cellular componenti

  1. cell junction Source: MGI
  2. juxtaparanode region of axon Source: MGI
  3. postsynaptic membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Disruption phenotypei

Mice do not respond to persistent pain. Postsynaptic surface expression of NMDA receptors and NMDA receptor-mediated synaptic function are reduced in dorsal horn neurons of the spinal chord.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 852852Disks large homolog 2PRO_0000094554Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi5 – 51S-palmitoyl cysteineBy similarity
Lipidationi7 – 71S-palmitoyl cysteineBy similarity
Modified residuei28 – 281Phosphoserine1 Publication
Modified residuei58 – 581Phosphotyrosine1 Publication
Modified residuei65 – 651Phosphoserine1 Publication
Modified residuei414 – 4141Phosphoserine1 Publication
Modified residuei505 – 5051Phosphotyrosine1 Publication
Modified residuei732 – 7321Phosphotyrosine1 Publication
Modified residuei737 – 7371Phosphotyrosine1 Publication

Post-translational modificationi

Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiQ91XM9.
PaxDbiQ91XM9.
PRIDEiQ91XM9.

PTM databases

PhosphoSiteiQ91XM9.

Expressioni

Tissue specificityi

Brain. Highest levels of isoform 1 in cortex, olfactory bulb, thalamus, hypothalamus, striatum and hippocampus. Highest level of isoform 2 in olfactory bulb. Reduced levels in cortex and hippocampus. Highest level of isoform 4 in spinal cord. Low levels of isoform 4, isoform 6, and isoform 7 in superior cervical ganglion.2 Publications

Gene expression databases

CleanExiMM_DLG2.
ExpressionAtlasiQ91XM9. baseline and differential.
GenevestigatoriQ91XM9.

Interactioni

Subunit structurei

Interacts with NOS1/nNOS through second PDZ domain. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains By similarity. Interacts with KCNJ4. Interacts with FRMPD4 (via C-terminus) By similarity. Interacts through its PDZ domains with Neto1. Interacts with LRFN1, LRFN2 and LRFN4. Interacts with FASLG By similarity. Interacts with KCNJ4 By similarity.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Dlg4Q621085EBI-400138,EBI-300895

Protein-protein interaction databases

BioGridi204763. 3 interactions.
DIPiDIP-31569N.
IntActiQ91XM9. 9 interactions.
MINTiMINT-136378.

Structurei

Secondary structure

1
852
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi95 – 1028
Turni104 – 1063
Beta strandi110 – 1145
Beta strandi127 – 1326
Helixi137 – 1415
Beta strandi149 – 1535
Helixi163 – 17210
Beta strandi175 – 18410

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2WL7X-ray2.03A95-188[»]
ProteinModelPortaliQ91XM9.
SMRiQ91XM9. Positions 93-283, 418-852.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ91XM9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini98 – 18588PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini193 – 28088PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini421 – 50282PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini536 – 60671SH3PROSITE-ProRule annotationAdd
BLAST
Domaini662 – 837176Guanylate kinase-likePROSITE-ProRule annotationAdd
BLAST

Domaini

Isoform 7 has an L27 domain close to N-terminus.

Sequence similaritiesi

Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiCOG0194.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ91XM9.
KOiK12075.
OrthoDBiEOG79GT6P.
TreeFamiTF323171.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23119. PTHR23119. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q91XM9-1) [UniParc]FASTAAdd to Basket

Also known as: PSD93-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFFACYCALR TNVKKYRYQD EDGPHDHSLP RLTHEVRGPE LVHVSEKNLS
60 70 80 90 100
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT
110 120 130 140 150
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI
160 170 180 190 200
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP
210 220 230 240 250
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN
260 270 280 290 300
YSLEEVTHEE AVAILKNTSD VVYLKVGKPT TIYMTDPYGP PDITHSYSPP
310 320 330 340 350
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLGEDDY TRPPEPVYST
360 370 380 390 400
VNKLCDKPAS PRHYSPVECD KSFLLSTPYP HYHLGLLPDS DMTSHSQHST
410 420 430 440 450
ATRQPSVTLQ RAISLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL
460 470 480 490 500
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY
510 520 530 540 550
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS
560 570 580 590 600
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVTLDGDS EEMGVIPSKR
610 620 630 640 650
RVERKERARL KTVKFNAKPG VIDSKGDIPG LGDDGYGTKT LRGQEDLILS
660 670 680 690 700
YEPVTRQEIN YTRPVIILGP MKDRINDDLI SEFPDKFGSC VPHTTRPKRD
710 720 730 740 750
YEVDGRDYHF VISREQMEKD IQEHKFIEAG QYNDNLYGTS VQSVRFVAER
760 770 780 790 800
GKHCILDVSG NAIKRLQVAQ LYPIAIFIKP KSLEPLMEMN KRLTEEQAKK
810 820 830 840 850
TYDRAIKLEQ EFGEYFTAIV QGDTLEDIYN QCKLVIEEQS GPFIWIPSKE

KL
Length:852
Mass (Da):94,880
Last modified:October 3, 2012 - v2
Checksum:i632914AE45ACEBB6
GO
Isoform 2 (identifier: Q91XM9-2) [UniParc]FASTAAdd to Basket

Also known as: PSD93-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC

Show »
Length:859
Mass (Da):95,531
Checksum:iD3BE703AE529AC57
GO
Isoform 3 (identifier: Q91XM9-3) [UniParc]FASTAAdd to Basket

Also known as: PSD93-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     62-68: SHISPLK → MQHAFIP

Show »
Length:791
Mass (Da):87,790
Checksum:i645487F4769B1768
GO
Isoform 4 (identifier: Q91XM9-4) [UniParc]FASTAAdd to Basket

Also known as: PSD93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:887
Mass (Da):97,928
Checksum:i7416EAB77947D245
GO
Isoform 5 (identifier: Q91XM9-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ
     394-394: S → RYCMRFLTSSSPVACVSTRMDGWNSSPPTSLALSTFLVERCSASMVRWEKLRTWLFCSFCCAH
     395-852: Missing.

Note: No experimental confirmation available.

Show »
Length:491
Mass (Da):53,570
Checksum:i0926554D5F3A8FE6
GO
Isoform 6 (identifier: Q91XM9-6) [UniParc]FASTAAdd to Basket

Also known as: PSD93 epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.
     43-67: HVSEKNLSQIENVHGYVLQSHISPL → MFASIWYAKKLGRRFVHNARKAKSE

Show »
Length:810
Mass (Da):90,071
Checksum:iE3F3ADB9E5ECA0D5
GO
Isoform 7 (identifier: Q91XM9-7) [UniParc]FASTAAdd to Basket

Also known as: PSD93 zeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MFFACYCALRTNVK → MPVKKKDTDR...PTWMPVHHCT
     69-86: Missing.

Show »
Length:976
Mass (Da):109,239
Checksum:i137F926A3694DC90
GO
Isoform 8 (identifier: Q91XM9-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     465-503: DQILSVNGID...VTIIAQYQPE → VINASVNRTG...LPALFPNFVL

Note: Incomplete sequence.

Show »
Length:852
Mass (Da):95,055
Checksum:iED0E8A1613E89FF5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti107 – 1071G → S in BAC32772. (PubMed:16141072)Curated
Sequence conflicti123 – 1231D → G in AAK64496. 1 PublicationCurated
Sequence conflicti213 – 2131N → D in AAK64496. 1 PublicationCurated
Sequence conflicti301 – 3011M → T in AAK64496. 1 PublicationCurated
Sequence conflicti323 – 3231S → P in AAK64496. 1 PublicationCurated
Sequence conflicti585 – 5851T → I in AAK64496. 1 PublicationCurated
Sequence conflicti776 – 7761I → T in AAK64496. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6868MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDI GRSAPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4 and isoform 5. 1 PublicationVSP_012869Add
BLAST
Alternative sequencei1 – 6161Missing in isoform 3. CuratedVSP_015517Add
BLAST
Alternative sequencei1 – 4242Missing in isoform 6. CuratedVSP_015518Add
BLAST
Alternative sequencei1 – 1414MFFAC…RTNVK → MPVKKKDTDRALSLLEEYCK KLRKPEEQLLKNAVKKVMSI FKSSLFQALLDIQEFYEVTL LNSQKSCEQKIEEANHVAQK WEKTLLLDSCRDSLQKSSEH ASCSGPKENALYIEQNKENQ CSENETEEKTCQNQGKCPAQ NCSVEAPTWMPVHHCT in isoform 7. CuratedVSP_015519Add
BLAST
Alternative sequencei1 – 1313MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2. CuratedVSP_015520Add
BLAST
Alternative sequencei43 – 6725HVSEK…HISPL → MFASIWYAKKLGRRFVHNAR KAKSE in isoform 6. CuratedVSP_015521Add
BLAST
Alternative sequencei62 – 687SHISPLK → MQHAFIP in isoform 3. CuratedVSP_015522
Alternative sequencei69 – 8618Missing in isoform 7. CuratedVSP_015523Add
BLAST
Alternative sequencei394 – 3941S → RYCMRFLTSSSPVACVSTRM DGWNSSPPTSLALSTFLVER CSASMVRWEKLRTWLFCSFC CAH in isoform 5. 1 PublicationVSP_012870
Alternative sequencei395 – 852458Missing in isoform 5. 1 PublicationVSP_012871Add
BLAST
Alternative sequencei465 – 50339DQILS…QYQPE → VINASVNRTGDRRIWHQGNG KAASSVSCLLPALFPNFVL in isoform 8. 1 PublicationVSP_015524Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF388675 mRNA. Translation: AAK64496.1.
AK046525 mRNA. Translation: BAC32772.1.
AK039754 mRNA. Translation: BAC30440.1.
AC100322 Genomic DNA. No translation available.
AC101784 Genomic DNA. No translation available.
AC108818 Genomic DNA. No translation available.
AC108832 Genomic DNA. No translation available.
AC109506 Genomic DNA. No translation available.
AC112262 Genomic DNA. No translation available.
AC118621 Genomic DNA. No translation available.
AC119218 Genomic DNA. No translation available.
AC121261 Genomic DNA. No translation available.
AC122002 Genomic DNA. No translation available.
AC127299 Genomic DNA. No translation available.
AC127683 Genomic DNA. No translation available.
AC140196 Genomic DNA. No translation available.
AC141890 Genomic DNA. No translation available.
AC161490 Genomic DNA. No translation available.
AC162304 Genomic DNA. No translation available.
CCDSiCCDS40021.1. [Q91XM9-1]
RefSeqiNP_001229976.1. NM_001243047.1.
NP_035937.2. NM_011807.3. [Q91XM9-1]
UniGeneiMm.147213.
Mm.257035.

Genome annotation databases

EnsembliENSMUST00000107196; ENSMUSP00000102814; ENSMUSG00000052572. [Q91XM9-1]
GeneIDi23859.
KEGGimmu:23859.
UCSCiuc009ihs.1. mouse. [Q91XM9-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF388675 mRNA. Translation: AAK64496.1 .
AK046525 mRNA. Translation: BAC32772.1 .
AK039754 mRNA. Translation: BAC30440.1 .
AC100322 Genomic DNA. No translation available.
AC101784 Genomic DNA. No translation available.
AC108818 Genomic DNA. No translation available.
AC108832 Genomic DNA. No translation available.
AC109506 Genomic DNA. No translation available.
AC112262 Genomic DNA. No translation available.
AC118621 Genomic DNA. No translation available.
AC119218 Genomic DNA. No translation available.
AC121261 Genomic DNA. No translation available.
AC122002 Genomic DNA. No translation available.
AC127299 Genomic DNA. No translation available.
AC127683 Genomic DNA. No translation available.
AC140196 Genomic DNA. No translation available.
AC141890 Genomic DNA. No translation available.
AC161490 Genomic DNA. No translation available.
AC162304 Genomic DNA. No translation available.
CCDSi CCDS40021.1. [Q91XM9-1 ]
RefSeqi NP_001229976.1. NM_001243047.1.
NP_035937.2. NM_011807.3. [Q91XM9-1 ]
UniGenei Mm.147213.
Mm.257035.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2WL7 X-ray 2.03 A 95-188 [» ]
ProteinModelPortali Q91XM9.
SMRi Q91XM9. Positions 93-283, 418-852.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204763. 3 interactions.
DIPi DIP-31569N.
IntActi Q91XM9. 9 interactions.
MINTi MINT-136378.

PTM databases

PhosphoSitei Q91XM9.

Proteomic databases

MaxQBi Q91XM9.
PaxDbi Q91XM9.
PRIDEi Q91XM9.

Protocols and materials databases

DNASUi 23859.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000107196 ; ENSMUSP00000102814 ; ENSMUSG00000052572 . [Q91XM9-1 ]
GeneIDi 23859.
KEGGi mmu:23859.
UCSCi uc009ihs.1. mouse. [Q91XM9-5 ]

Organism-specific databases

CTDi 1740.
MGIi MGI:1344351. Dlg2.

Phylogenomic databases

eggNOGi COG0194.
GeneTreei ENSGT00760000118866.
HOGENOMi HOG000232102.
HOVERGENi HBG107814.
InParanoidi Q91XM9.
KOi K12075.
OrthoDBi EOG79GT6P.
TreeFami TF323171.

Miscellaneous databases

ChiTaRSi DLG2. mouse.
EvolutionaryTracei Q91XM9.
NextBioi 303569.
PROi Q91XM9.
SOURCEi Search...

Gene expression databases

CleanExi MM_DLG2.
ExpressionAtlasi Q91XM9. baseline and differential.
Genevestigatori Q91XM9.

Family and domain databases

Gene3Di 2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProi IPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view ]
PANTHERi PTHR23119. PTHR23119. 1 hit.
Pfami PF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view ]
PIRSFi PIRSF001741. MAGUK_DLGH. 1 hit.
SMARTi SM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and sequencing of mouse PSD-93 cDNA."
    Yamashita T., Mochizuki C., Miyagi Y., Sonoda T., Kawamoto S.
    Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: BALB/c.
    Tissue: Cerebellum.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 465-852 (ISOFORM 8).
    Strain: C57BL/6J.
    Tissue: Adrenal gland and Spinal cord.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "Inward rectifier K+ channel Kir2.3 is localized at the postsynaptic membrane of excitatory synapses."
    Inanobe A., Fujita A., Ito M., Tomoike H., Inageda K., Kurachi Y.
    Am. J. Physiol. 282:C1396-C1403(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KCNJ4.
  5. "Impaired NMDA receptor-mediated postsynaptic function and blunted NMDA receptor-dependent persistent pain in mice lacking postsynaptic density-93 protein."
    Tao Y.-X., Rumbaugh G., Wang G.-D., Petralia R.S., Zhao C., Kauer F.W., Tao F., Zhuo M., Wenthold R.J., Raja S.N., Huganir R.L., Bredt D.S., Johns R.A.
    J. Neurosci. 23:6703-6712(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
  6. "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1."
    Leyland M.L., Dart C.
    J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  7. "PSD93 regulates synaptic stability at neuronal cholinergic synapses."
    Parker M.J., Zhao S., Bredt D.S., Sanes J.R., Feng G.
    J. Neurosci. 24:378-388(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING.
  8. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28 AND SER-414, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  9. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
    Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
    J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-58; SER-65; TYR-505; TYR-732 AND TYR-737, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  10. "Neto1 is a novel CUB-domain NMDA receptor-interacting protein required for synaptic plasticity and learning."
    Ng D., Pitcher G.M., Szilard R.K., Sertie A., Kanisek M., Clapcote S.J., Lipina T., Kalia L.V., Joo D., McKerlie C., Cortez M., Roder J.C., Salter M.W., McInnes R.R.
    PLoS Biol. 7:E41-E41(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH NETO1.
  11. Cited for: X-RAY CRYSTALLOGRAPHY (2.03 ANGSTROMS) OF 95-188.

Entry informationi

Entry nameiDLG2_MOUSE
AccessioniPrimary (citable) accession number: Q91XM9
Secondary accession number(s): F8VQM7, Q8BXK7, Q8BYG5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: October 3, 2012
Last modified: October 29, 2014
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3