Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like

Gene

Dus3l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.By similarity

Cofactori

FMNBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei352FMNBy similarity1
Active sitei383Proton donorBy similarity1
Binding sitei422FMNBy similarity1
Binding sitei452FMNBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri107 – 137C3H1-type 1PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri145 – 175C3H1-type 2PROSITE-ProRule annotationAdd BLAST31
Nucleotide bindingi298 – 300FMNBy similarity3
Nucleotide bindingi484 – 486FMNBy similarity3
Nucleotide bindingi507 – 508FMNBy similarity2

GO - Molecular functioni

Keywordsi

Molecular functionOxidoreductase
Biological processtRNA processing
LigandFlavoprotein, FMN, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like (EC:1.3.1.-)
Alternative name(s):
tRNA-dihydrouridine synthase 3-like
Gene namesi
Name:Dus3l
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:2147092 Dus3l

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002473431 – 637tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-likeAdd BLAST637

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei260PhosphothreonineCombined sources1
Modified residuei263PhosphoserineCombined sources1
Modified residuei264PhosphoserineCombined sources1
Cross-linki403Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ91XI1
PaxDbiQ91XI1
PeptideAtlasiQ91XI1
PRIDEiQ91XI1

PTM databases

iPTMnetiQ91XI1
PhosphoSitePlusiQ91XI1

Expressioni

Gene expression databases

CleanExiMM_DUS3L

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000007747

Structurei

3D structure databases

ProteinModelPortaliQ91XI1
SMRiQ91XI1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the Dus family. Dus3 subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri107 – 137C3H1-type 1PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri145 – 175C3H1-type 2PROSITE-ProRule annotationAdd BLAST31

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG2333 Eukaryota
COG0042 LUCA
HOGENOMiHOG000240610
HOVERGENiHBG062413
InParanoidiQ91XI1
KOiK05544
PhylomeDBiQ91XI1
TreeFamiTF105726

Family and domain databases

CDDicd02801 DUS_like_FMN, 1 hit
Gene3Di3.20.20.70, 1 hit
InterProiView protein in InterPro
IPR013785 Aldolase_TIM
IPR035587 DUS-like_FMN-bd
IPR001269 tRNA_hU_synthase
IPR018517 tRNA_hU_synthase_CS
IPR000571 Znf_CCCH
PANTHERiPTHR11082 PTHR11082, 1 hit
PfamiView protein in Pfam
PF01207 Dus, 1 hit
PROSITEiView protein in PROSITE
PS01136 UPF0034, 1 hit
PS50103 ZF_C3H1, 2 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q91XI1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAETAAESGG GGDSGVGACE RGVAPIKAQY RTTKERFHEY LDGDKQEGAC
60 70 80 90 100
QEVPTGDPAE PGAKRIRLED GQENGKTEVA IESRERQVPK RARGQNKSRP
110 120 130 140 150
HVKPAHYDKD RLCPSFLQEP ATPCAFGDRC RFLHDVGRYL ETKPADLGPR
160 170 180 190 200
CVLFETFGRC PFSMTCRFAG AHLGPEGQNL VQEEVVARCA QLPSVRNGLD
210 220 230 240 250
RALQQQLRKR QVCFERAEQA LNRLTQSPMP TVVPETTVAM ATPKQNSCHA
260 270 280 290 300
QLDTVGGAGT PQSSPVPTCG PLTDEDVIRL RPCEKKRLDI SGKLYLAPLT
310 320 330 340 350
TCGNLPFRRI CKRFGADVTC GEMAVCTNLL QGQMSEWALL KRHPCEDIFG
360 370 380 390 400
VQLEGAFPDT MTKCAELLNR TIDVDFVDIN VGCPIDLVYK KGGGCALMNR
410 420 430 440 450
SAKFQQIVRG VNGVLDVPLT VKMRTGVQER VSLAHRLLPE LRDWGVALVT
460 470 480 490 500
LHGRSREQRY TRLADWPYIE QCAKVASPMP LFGNGDILSF EDANCAMQTG
510 520 530 540 550
VAGIMVARGA LLKPWLFTEI KEQRHWDISS SERLDILRDF THYGLEHWGS
560 570 580 590 600
DTQGVERTRR FLLEWLSFLC RYVPVGLLER PPQRINERPP YYLGRDYLET
610 620 630
LMASQQAADW IRISEMLLGP VPPGFVFLPK HKANAYK
Length:637
Mass (Da):71,078
Last modified:December 1, 2001 - v1
Checksum:i759FE837CAEBC34A
GO
Isoform 2 (identifier: Q91XI1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-457: GGGCALMNRS...LVTLHGRSRE → VMAALPWSLGWVWPKPGTLPCWPCVSVSPSGHGAH
     458-637: Missing.

Note: No experimental confirmation available.
Show »
Length:426
Mass (Da):46,697
Checksum:iBDF677ADA4DC1307
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti413G → E in BAE34157 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019973392 – 457GGGCA…GRSRE → VMAALPWSLGWVWPKPGTLP CWPCVSVSPSGHGAH in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_019974458 – 637Missing in isoform 2. 1 PublicationAdd BLAST180

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY040840 mRNA Translation: AAK84684.1
AK157702 mRNA Translation: BAE34157.1
BC052481 mRNA Translation: AAH52481.1
CCDSiCCDS28914.1 [Q91XI1-1]
RefSeqiNP_659107.2, NM_144858.2
UniGeneiMm.293973

Genome annotation databases

GeneIDi224907
KEGGimmu:224907
UCSCiuc008ddd.2 mouse [Q91XI1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDUS3L_MOUSE
AccessioniPrimary (citable) accession number: Q91XI1
Secondary accession number(s): Q3TZQ1, Q7TT12
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 1, 2001
Last modified: March 28, 2018
This is version 124 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health