Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 3

Gene

Arhgef3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-MMU-193648. NRAGE signals death through JNK.
R-MMU-194840. Rho GTPase cycle.
R-MMU-416482. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 3
Gene namesi
Name:Arhgef3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1918954. Arhgef3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 524524Rho guanine nucleotide exchange factor 3PRO_0000080913Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei46 – 461PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ91X46.
MaxQBiQ91X46.
PaxDbiQ91X46.
PeptideAtlasiQ91X46.
PRIDEiQ91X46.

PTM databases

iPTMnetiQ91X46.
PhosphoSiteiQ91X46.

Expressioni

Gene expression databases

BgeeiQ91X46.
CleanExiMM_ARHGEF3.
GenevisibleiQ91X46. MM.

Interactioni

Subunit structurei

Interacts with RHOA and RHOB.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000046486.

Structurei

Secondary structure

1
524
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi117 – 14630Combined sources
Helixi148 – 1536Combined sources
Helixi159 – 1668Combined sources
Helixi169 – 18618Combined sources
Helixi197 – 2037Combined sources
Helixi204 – 2085Combined sources
Helixi209 – 22719Combined sources
Helixi231 – 2344Combined sources
Turni251 – 2533Combined sources
Helixi254 – 2563Combined sources
Helixi257 – 27418Combined sources
Helixi282 – 31534Combined sources
Helixi326 – 3294Combined sources
Beta strandi334 – 3429Combined sources
Beta strandi347 – 36519Combined sources
Beta strandi368 – 3758Combined sources
Helixi380 – 3823Combined sources
Beta strandi384 – 3874Combined sources
Turni390 – 3923Combined sources
Helixi405 – 4084Combined sources
Beta strandi410 – 4178Combined sources
Helixi420 – 4223Combined sources
Beta strandi424 – 4296Combined sources
Helixi433 – 44715Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2Z0QX-ray1.79A110-448[»]
ProteinModelPortaliQ91X46.
SMRiQ91X46. Positions 113-448.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ91X46.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini121 – 303183DHPROSITE-ProRule annotationAdd
BLAST
Domaini290 – 448159PHPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4305. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00840000129831.
HOGENOMiHOG000034044.
HOVERGENiHBG050567.
InParanoidiQ91X46.
OMAiTKLEQMD.
OrthoDBiEOG7J446D.
PhylomeDBiQ91X46.
TreeFamiTF328974.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q91X46-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVAKDYPFYL TVKRANCSLE APLGSGVAKD EEPSNKRVKP LSRVTSLANL
60 70 80 90 100
IPPVKTTPLK RFSQTLQRSI SFRSESRPDI LAPRAWSRNA TSSSTKRRDS
110 120 130 140 150
KLWSETFDVC VNQVLTAKEI KRQEAIFELS QGEEDLIEDL KLAKKAYHDP
160 170 180 190 200
MLKLSIMTEQ ELNQIFGTLD SLIPLHEELL SQLRDVRKPD GSTEHVGPIL
210 220 230 240 250
VGWLPCLSSY DSYCSNQVAA KALLDHKKQD HRVQDFLQRC LESPFSRKLD
260 270 280 290 300
LWNFLDIPRS RLVKYPLLLR EILRHTPNDN PDQQHLEEAI NIIQGIVAEI
310 320 330 340 350
NTKTGESECR YYKERLLYLE EGQKDSLIDS SRVLCCHGEL KNNRGVKLHV
360 370 380 390 400
FLFQEVLVIT RAVTHNEQLC YQLYRQPIPV KDLTLEDLQD GEVRLGGSLR
410 420 430 440 450
GAFSNNERVK NFFRVSFKNG SQSQTHSLQA NDTFNKQQWL NCIRQAKETV
460 470 480 490 500
LSAAGQAGLL DSEGLVQGPG TENREPQGET KLEQMDQSDS ESDCSMDTSE
510 520
VSLECERMEQ TDASCANSRP EESV
Length:524
Mass (Da):59,526
Last modified:December 1, 2001 - v1
Checksum:i579FF96C1F0B0ADA
GO
Isoform 2 (identifier: Q91X46-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MVAKDYPFYLTVKRANCSLEAPLGSGVAKDE → MRSERPMVWCCFFLRAQRKRKQSSQDEDAVSLCSLDIS

Show »
Length:531
Mass (Da):60,661
Checksum:i1497ED27F920AC1D
GO
Isoform 3 (identifier: Q91X46-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MVAKDYPFYLTVKRANCSLEAPLGSGVAKDE → MFPSPKACNFRGRKRKQSSQDEDAVSLCSLDIS

Show »
Length:526
Mass (Da):59,855
Checksum:i759D548498E81FF5
GO

Sequence cautioni

The sequence AAH07153.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti363 – 3631V → I in AAH05517 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3131MVAKD…VAKDE → MRSERPMVWCCFFLRAQRKR KQSSQDEDAVSLCSLDIS in isoform 2. 1 PublicationVSP_011613Add
BLAST
Alternative sequencei1 – 3131MVAKD…VAKDE → MFPSPKACNFRGRKRKQSSQ DEDAVSLCSLDIS in isoform 3. 1 PublicationVSP_011614Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004600 mRNA. Translation: BAB23401.1.
AK029872 mRNA. Translation: BAC26652.1.
BC005517 mRNA. Translation: AAH05517.1.
BC007153 mRNA. Translation: AAH07153.1. Different initiation.
BC012262 mRNA. Translation: AAH12262.1.
CCDSiCCDS26886.1. [Q91X46-2]
RefSeqiNP_001276615.1. NM_001289686.1.
NP_001276616.1. NM_001289687.1. [Q91X46-1]
NP_001276617.1. NM_001289688.1.
NP_082147.1. NM_027871.2. [Q91X46-2]
UniGeneiMm.248606.

Genome annotation databases

EnsembliENSMUST00000049206; ENSMUSP00000046486; ENSMUSG00000021895. [Q91X46-2]
GeneIDi71704.
KEGGimmu:71704.
UCSCiuc007sto.2. mouse. [Q91X46-2]
uc007str.2. mouse. [Q91X46-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004600 mRNA. Translation: BAB23401.1.
AK029872 mRNA. Translation: BAC26652.1.
BC005517 mRNA. Translation: AAH05517.1.
BC007153 mRNA. Translation: AAH07153.1. Different initiation.
BC012262 mRNA. Translation: AAH12262.1.
CCDSiCCDS26886.1. [Q91X46-2]
RefSeqiNP_001276615.1. NM_001289686.1.
NP_001276616.1. NM_001289687.1. [Q91X46-1]
NP_001276617.1. NM_001289688.1.
NP_082147.1. NM_027871.2. [Q91X46-2]
UniGeneiMm.248606.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2Z0QX-ray1.79A110-448[»]
ProteinModelPortaliQ91X46.
SMRiQ91X46. Positions 113-448.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000046486.

PTM databases

iPTMnetiQ91X46.
PhosphoSiteiQ91X46.

Proteomic databases

EPDiQ91X46.
MaxQBiQ91X46.
PaxDbiQ91X46.
PeptideAtlasiQ91X46.
PRIDEiQ91X46.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000049206; ENSMUSP00000046486; ENSMUSG00000021895. [Q91X46-2]
GeneIDi71704.
KEGGimmu:71704.
UCSCiuc007sto.2. mouse. [Q91X46-2]
uc007str.2. mouse. [Q91X46-1]

Organism-specific databases

CTDi50650.
MGIiMGI:1918954. Arhgef3.

Phylogenomic databases

eggNOGiKOG4305. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00840000129831.
HOGENOMiHOG000034044.
HOVERGENiHBG050567.
InParanoidiQ91X46.
OMAiTKLEQMD.
OrthoDBiEOG7J446D.
PhylomeDBiQ91X46.
TreeFamiTF328974.

Enzyme and pathway databases

ReactomeiR-MMU-193648. NRAGE signals death through JNK.
R-MMU-194840. Rho GTPase cycle.
R-MMU-416482. G alpha (12/13) signalling events.

Miscellaneous databases

EvolutionaryTraceiQ91X46.
PROiQ91X46.
SOURCEiSearch...

Gene expression databases

BgeeiQ91X46.
CleanExiMM_ARHGEF3.
GenevisibleiQ91X46. MM.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Lung and Testis.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: Czech II and FVB/N.
    Tissue: Mammary tumor and Salivary gland.
  3. "The Rho exchange factor Net1 is regulated by nuclear sequestration."
    Schmidt A., Hall A.
    J. Biol. Chem. 277:14581-14588(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  4. "Structure of the Rho-specific guanine nucleotide-exchange factor Xpln."
    Murayama K., Kato-Murayama M., Akasaka R., Terada T., Yokoyama S., Shirouzu M.
    Acta Crystallogr. F 68:1455-1459(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.79 ANGSTROMS) OF 110-448.

Entry informationi

Entry nameiARHG3_MOUSE
AccessioniPrimary (citable) accession number: Q91X46
Secondary accession number(s): Q8CDM0
, Q91VY4, Q99K14, Q9DC31
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: December 1, 2001
Last modified: July 6, 2016
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.