Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 3

Gene

Arhgef3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-MMU-193648. NRAGE signals death through JNK.
R-MMU-194840. Rho GTPase cycle.
R-MMU-416482. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 3
Gene namesi
Name:Arhgef3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1918954. Arhgef3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809131 – 524Rho guanine nucleotide exchange factor 3Add BLAST524

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei46PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ91X46.
PeptideAtlasiQ91X46.
PRIDEiQ91X46.

PTM databases

iPTMnetiQ91X46.
PhosphoSitePlusiQ91X46.

Expressioni

Gene expression databases

BgeeiENSMUSG00000021895.
CleanExiMM_ARHGEF3.
GenevisibleiQ91X46. MM.

Interactioni

Subunit structurei

Interacts with RHOA and RHOB.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000046486.

Structurei

Secondary structure

1524
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi117 – 146Combined sources30
Helixi148 – 153Combined sources6
Helixi159 – 166Combined sources8
Helixi169 – 186Combined sources18
Helixi197 – 203Combined sources7
Helixi204 – 208Combined sources5
Helixi209 – 227Combined sources19
Helixi231 – 234Combined sources4
Turni251 – 253Combined sources3
Helixi254 – 256Combined sources3
Helixi257 – 274Combined sources18
Helixi282 – 315Combined sources34
Helixi326 – 329Combined sources4
Beta strandi334 – 342Combined sources9
Beta strandi347 – 365Combined sources19
Beta strandi368 – 375Combined sources8
Helixi380 – 382Combined sources3
Beta strandi384 – 387Combined sources4
Turni390 – 392Combined sources3
Helixi405 – 408Combined sources4
Beta strandi410 – 417Combined sources8
Helixi420 – 422Combined sources3
Beta strandi424 – 429Combined sources6
Helixi433 – 447Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Z0QX-ray1.79A110-448[»]
ProteinModelPortaliQ91X46.
SMRiQ91X46.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ91X46.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini121 – 303DHPROSITE-ProRule annotationAdd BLAST183
Domaini290 – 448PHPROSITE-ProRule annotationAdd BLAST159

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4305. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00760000119193.
HOGENOMiHOG000034044.
HOVERGENiHBG050567.
InParanoidiQ91X46.
KOiK20683.
OMAiTKLEQMD.
OrthoDBiEOG091G05S7.
PhylomeDBiQ91X46.
TreeFamiTF328974.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q91X46-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVAKDYPFYL TVKRANCSLE APLGSGVAKD EEPSNKRVKP LSRVTSLANL
60 70 80 90 100
IPPVKTTPLK RFSQTLQRSI SFRSESRPDI LAPRAWSRNA TSSSTKRRDS
110 120 130 140 150
KLWSETFDVC VNQVLTAKEI KRQEAIFELS QGEEDLIEDL KLAKKAYHDP
160 170 180 190 200
MLKLSIMTEQ ELNQIFGTLD SLIPLHEELL SQLRDVRKPD GSTEHVGPIL
210 220 230 240 250
VGWLPCLSSY DSYCSNQVAA KALLDHKKQD HRVQDFLQRC LESPFSRKLD
260 270 280 290 300
LWNFLDIPRS RLVKYPLLLR EILRHTPNDN PDQQHLEEAI NIIQGIVAEI
310 320 330 340 350
NTKTGESECR YYKERLLYLE EGQKDSLIDS SRVLCCHGEL KNNRGVKLHV
360 370 380 390 400
FLFQEVLVIT RAVTHNEQLC YQLYRQPIPV KDLTLEDLQD GEVRLGGSLR
410 420 430 440 450
GAFSNNERVK NFFRVSFKNG SQSQTHSLQA NDTFNKQQWL NCIRQAKETV
460 470 480 490 500
LSAAGQAGLL DSEGLVQGPG TENREPQGET KLEQMDQSDS ESDCSMDTSE
510 520
VSLECERMEQ TDASCANSRP EESV
Length:524
Mass (Da):59,526
Last modified:December 1, 2001 - v1
Checksum:i579FF96C1F0B0ADA
GO
Isoform 2 (identifier: Q91X46-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MVAKDYPFYLTVKRANCSLEAPLGSGVAKDE → MRSERPMVWCCFFLRAQRKRKQSSQDEDAVSLCSLDIS

Show »
Length:531
Mass (Da):60,661
Checksum:i1497ED27F920AC1D
GO
Isoform 3 (identifier: Q91X46-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MVAKDYPFYLTVKRANCSLEAPLGSGVAKDE → MFPSPKACNFRGRKRKQSSQDEDAVSLCSLDIS

Show »
Length:526
Mass (Da):59,855
Checksum:i759D548498E81FF5
GO

Sequence cautioni

The sequence AAH07153 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti363V → I in AAH05517 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0116131 – 31MVAKD…VAKDE → MRSERPMVWCCFFLRAQRKR KQSSQDEDAVSLCSLDIS in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_0116141 – 31MVAKD…VAKDE → MFPSPKACNFRGRKRKQSSQ DEDAVSLCSLDIS in isoform 3. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004600 mRNA. Translation: BAB23401.1.
AK029872 mRNA. Translation: BAC26652.1.
BC005517 mRNA. Translation: AAH05517.1.
BC007153 mRNA. Translation: AAH07153.1. Different initiation.
BC012262 mRNA. Translation: AAH12262.1.
CCDSiCCDS26886.1. [Q91X46-2]
RefSeqiNP_001276615.1. NM_001289686.1.
NP_001276616.1. NM_001289687.1. [Q91X46-1]
NP_001276617.1. NM_001289688.1.
NP_082147.1. NM_027871.2. [Q91X46-2]
UniGeneiMm.248606.

Genome annotation databases

EnsembliENSMUST00000049206; ENSMUSP00000046486; ENSMUSG00000021895. [Q91X46-2]
GeneIDi71704.
KEGGimmu:71704.
UCSCiuc007sto.2. mouse. [Q91X46-2]
uc007str.2. mouse. [Q91X46-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004600 mRNA. Translation: BAB23401.1.
AK029872 mRNA. Translation: BAC26652.1.
BC005517 mRNA. Translation: AAH05517.1.
BC007153 mRNA. Translation: AAH07153.1. Different initiation.
BC012262 mRNA. Translation: AAH12262.1.
CCDSiCCDS26886.1. [Q91X46-2]
RefSeqiNP_001276615.1. NM_001289686.1.
NP_001276616.1. NM_001289687.1. [Q91X46-1]
NP_001276617.1. NM_001289688.1.
NP_082147.1. NM_027871.2. [Q91X46-2]
UniGeneiMm.248606.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Z0QX-ray1.79A110-448[»]
ProteinModelPortaliQ91X46.
SMRiQ91X46.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000046486.

PTM databases

iPTMnetiQ91X46.
PhosphoSitePlusiQ91X46.

Proteomic databases

PaxDbiQ91X46.
PeptideAtlasiQ91X46.
PRIDEiQ91X46.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000049206; ENSMUSP00000046486; ENSMUSG00000021895. [Q91X46-2]
GeneIDi71704.
KEGGimmu:71704.
UCSCiuc007sto.2. mouse. [Q91X46-2]
uc007str.2. mouse. [Q91X46-1]

Organism-specific databases

CTDi50650.
MGIiMGI:1918954. Arhgef3.

Phylogenomic databases

eggNOGiKOG4305. Eukaryota.
COG5422. LUCA.
GeneTreeiENSGT00760000119193.
HOGENOMiHOG000034044.
HOVERGENiHBG050567.
InParanoidiQ91X46.
KOiK20683.
OMAiTKLEQMD.
OrthoDBiEOG091G05S7.
PhylomeDBiQ91X46.
TreeFamiTF328974.

Enzyme and pathway databases

ReactomeiR-MMU-193648. NRAGE signals death through JNK.
R-MMU-194840. Rho GTPase cycle.
R-MMU-416482. G alpha (12/13) signalling events.

Miscellaneous databases

EvolutionaryTraceiQ91X46.
PROiQ91X46.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021895.
CleanExiMM_ARHGEF3.
GenevisibleiQ91X46. MM.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR001331. GDS_CDC24_CS.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS00741. DH_1. 1 hit.
PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARHG3_MOUSE
AccessioniPrimary (citable) accession number: Q91X46
Secondary accession number(s): Q8CDM0
, Q91VY4, Q99K14, Q9DC31
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.