Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Activating signal cointegrator 1 complex subunit 2

Gene

Ascc2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Enhances NF-kappa-B, SRF and AP1 transactivation.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Activating signal cointegrator 1 complex subunit 2
Alternative name(s):
ASC-1 complex subunit p100
Trip4 complex subunit p100
Gene namesi
Name:Ascc2
Synonyms:Asc1p100
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1922702. Ascc2.

Subcellular locationi

  • Nucleus By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000646901 – 749Activating signal cointegrator 1 complex subunit 2Add BLAST749

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei233PhosphothreonineBy similarity1
Modified residuei625PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ91WR3.
PaxDbiQ91WR3.
PeptideAtlasiQ91WR3.
PRIDEiQ91WR3.

PTM databases

iPTMnetiQ91WR3.
PhosphoSitePlusiQ91WR3.

Miscellaneous databases

PMAP-CutDBQ91WR3.

Expressioni

Gene expression databases

BgeeiENSMUSG00000020412.
GenevisibleiQ91WR3. MM.

Interactioni

Subunit structurei

Part of the ASC-1 complex, that contains TRIP4, ASCC1, ASCC2 and ASCC3. The ASC-1 complex interacts with ALKBH3 (By similarity). Interacts with CSRP1 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000063272.

Structurei

3D structure databases

ProteinModelPortaliQ91WR3.
SMRiQ91WR3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini465 – 508CUEPROSITE-ProRule annotationAdd BLAST44

Sequence similaritiesi

Belongs to the ASCC2 family.Curated
Contains 1 CUE domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4501. Eukaryota.
ENOG410XSUE. LUCA.
GeneTreeiENSGT00390000018806.
HOGENOMiHOG000234347.
HOVERGENiHBG050589.
InParanoidiQ91WR3.
KOiK18667.
OMAiMNQICLL.
OrthoDBiEOG091G06RW.
PhylomeDBiQ91WR3.
TreeFamiTF323459.

Family and domain databases

InterProiIPR003892. CUE.
IPR009060. UBA-like.
[Graphical view]
PfamiPF02845. CUE. 1 hit.
[Graphical view]
SMARTiSM00546. CUE. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
PROSITEiPS51140. CUE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q91WR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPALPLDQLQ ITHKDPKTGQ PKTSAALNPE QKADRYFVLY KPPPKDNIPA
60 70 80 90 100
LVEEYLERAN FVANDLDWLL ALPHDKFWCQ VIFDETLQKC LDSYLHYVPR
110 120 130 140 150
KFDEWVAPTP EVADMQNHLH RSVFLTFLRM STHKESKDHF ISPSAFGEIL
160 170 180 190 200
YNNFLFDIPK ILDLCVLFGK GNSPLLQKMI GNIFTQQPSY YTDLDETIPT
210 220 230 240 250
ILQVFSNILQ HCGLQGDGTS TTPQKLGERS PLTPSDMPLL ELKDIVLYLC
260 270 280 290 300
DTSTTLWAFL DIFPLACQTF QKHDFCYRLA SFYEMAIPEL ESAIKKRRLE
310 320 330 340 350
DSKLLGDMWQ RLSHSKKKLM EVFHIILNQI CLLPILESSC DNIQGFIEEF
360 370 380 390 400
LQIFSSLLQE KRFLRDYDTF SPVAEDISLL QQASSALDET RTAYILQAVE
410 420 430 440 450
SAWEGVDRQK IKDIKDPPRA KGSNNEVTVT AEPVSEMPSQ LENLEEDEEC
460 470 480 490 500
MGAAAALGPA VSGVELDSLI SQVKDLLPDL GEGFILACLE HYSYDSEQVI
510 520 530 540 550
NNILEDRLAP ELSQLDRGLE RQVKPDPTPL LSSRHNIFQN DEFDVFSRDS
560 570 580 590 600
VDLSRVHKGR RKEENVRSLV NDKQAVVAQW QRYQKYSVVV EEVPLQPGEY
610 620 630 640 650
QADDYEDEYD DTYDGNQVGA NDADSDDELI SRRPFTIPQV LRTKMPGEVQ
660 670 680 690 700
EEEWDEEDEV EEEAPKPDHF IQDPAVLREK AEARRMAFLA RKGYRPENST
710 720 730 740
AVTGGPRGHG QSRETTQERR KKEANKAARA NHNRRTMADR KRSKGMIPS
Length:749
Mass (Da):85,653
Last modified:December 1, 2001 - v1
Checksum:i9923D4BE00B7C3AB
GO
Isoform 2 (identifier: Q91WR3-2) [UniParc]FASTAAdd to basket
Also known as: 100S

The sequence of this isoform differs from the canonical sequence as follows:
     522-561: Missing.

Show »
Length:709
Mass (Da):80,976
Checksum:iA4FE31AA6E9B3BA6
GO
Isoform 3 (identifier: Q91WR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     733-749: NRRTMADRKRSKGMIPS → KSFCAPEMDYERPEGLRRGAELAVCPWCLSSGCVCPC

Note: Incomplete sequence.
Show »
Length:769
Mass (Da):87,713
Checksum:i47B08C3AF9548238
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011012522 – 561Missing in isoform 2. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_011013733 – 749NRRTM…GMIPS → KSFCAPEMDYERPEGLRRGA ELAVCPWCLSSGCVCPC in isoform 3. CuratedAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048876 mRNA. Translation: BAC33480.1.
AK051387 mRNA. Translation: BAC34621.1.
AL606521 Genomic DNA. Translation: CAI35279.1.
BC013537 mRNA. Translation: AAH13537.1.
BC024840 mRNA. Translation: AAH24840.1.
CCDSiCCDS24387.1. [Q91WR3-1]
RefSeqiNP_083567.1. NM_029291.1. [Q91WR3-1]
UniGeneiMm.439906.

Genome annotation databases

EnsembliENSMUST00000070257; ENSMUSP00000063272; ENSMUSG00000020412. [Q91WR3-1]
ENSMUST00000109930; ENSMUSP00000105556; ENSMUSG00000020412. [Q91WR3-2]
GeneIDi75452.
KEGGimmu:75452.
UCSCiuc007hva.2. mouse. [Q91WR3-1]
uc011xqz.2. mouse. [Q91WR3-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048876 mRNA. Translation: BAC33480.1.
AK051387 mRNA. Translation: BAC34621.1.
AL606521 Genomic DNA. Translation: CAI35279.1.
BC013537 mRNA. Translation: AAH13537.1.
BC024840 mRNA. Translation: AAH24840.1.
CCDSiCCDS24387.1. [Q91WR3-1]
RefSeqiNP_083567.1. NM_029291.1. [Q91WR3-1]
UniGeneiMm.439906.

3D structure databases

ProteinModelPortaliQ91WR3.
SMRiQ91WR3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000063272.

PTM databases

iPTMnetiQ91WR3.
PhosphoSitePlusiQ91WR3.

Proteomic databases

EPDiQ91WR3.
PaxDbiQ91WR3.
PeptideAtlasiQ91WR3.
PRIDEiQ91WR3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000070257; ENSMUSP00000063272; ENSMUSG00000020412. [Q91WR3-1]
ENSMUST00000109930; ENSMUSP00000105556; ENSMUSG00000020412. [Q91WR3-2]
GeneIDi75452.
KEGGimmu:75452.
UCSCiuc007hva.2. mouse. [Q91WR3-1]
uc011xqz.2. mouse. [Q91WR3-2]

Organism-specific databases

CTDi84164.
MGIiMGI:1922702. Ascc2.

Phylogenomic databases

eggNOGiKOG4501. Eukaryota.
ENOG410XSUE. LUCA.
GeneTreeiENSGT00390000018806.
HOGENOMiHOG000234347.
HOVERGENiHBG050589.
InParanoidiQ91WR3.
KOiK18667.
OMAiMNQICLL.
OrthoDBiEOG091G06RW.
PhylomeDBiQ91WR3.
TreeFamiTF323459.

Miscellaneous databases

ChiTaRSiAscc2. mouse.
PMAP-CutDBQ91WR3.
PROiQ91WR3.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020412.
GenevisibleiQ91WR3. MM.

Family and domain databases

InterProiIPR003892. CUE.
IPR009060. UBA-like.
[Graphical view]
PfamiPF02845. CUE. 1 hit.
[Graphical view]
SMARTiSM00546. CUE. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
PROSITEiPS51140. CUE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiASCC2_MOUSE
AccessioniPrimary (citable) accession number: Q91WR3
Secondary accession number(s): Q5NCK1
, Q8BKM9, Q8BX60, Q8R1B9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: December 1, 2001
Last modified: November 30, 2016
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.