Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Activating signal cointegrator 1 complex subunit 2

Gene

Ascc2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Enhances NF-kappa-B, SRF and AP1 transactivation.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Activating signal cointegrator 1 complex subunit 2
Alternative name(s):
ASC-1 complex subunit p100
Trip4 complex subunit p100
Gene namesi
Name:Ascc2
Synonyms:Asc1p100
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1922702. Ascc2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 749749Activating signal cointegrator 1 complex subunit 2PRO_0000064690Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei625 – 6251PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ91WR3.
MaxQBiQ91WR3.
PaxDbiQ91WR3.
PRIDEiQ91WR3.

PTM databases

iPTMnetiQ91WR3.
PhosphoSiteiQ91WR3.

Miscellaneous databases

PMAP-CutDBQ91WR3.

Expressioni

Gene expression databases

BgeeiQ91WR3.
GenevisibleiQ91WR3. MM.

Interactioni

Subunit structurei

Part of TRIP4 complex, that contains ASCC1, ASCC2 and ASCC3. The TRIP4 complex interacts with ALKHB3 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000063272.

Structurei

3D structure databases

ProteinModelPortaliQ91WR3.
SMRiQ91WR3. Positions 463-523.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini465 – 50844CUEPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the ASCC2 family.Curated
Contains 1 CUE domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4501. Eukaryota.
ENOG410XSUE. LUCA.
GeneTreeiENSGT00390000018806.
HOGENOMiHOG000234347.
HOVERGENiHBG050589.
InParanoidiQ91WR3.
KOiK18667.
OMAiMNQICLL.
OrthoDBiEOG708VZP.
PhylomeDBiQ91WR3.
TreeFamiTF323459.

Family and domain databases

InterProiIPR003892. CUE.
IPR009060. UBA-like.
[Graphical view]
PfamiPF02845. CUE. 1 hit.
[Graphical view]
SMARTiSM00546. CUE. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
PROSITEiPS51140. CUE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q91WR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPALPLDQLQ ITHKDPKTGQ PKTSAALNPE QKADRYFVLY KPPPKDNIPA
60 70 80 90 100
LVEEYLERAN FVANDLDWLL ALPHDKFWCQ VIFDETLQKC LDSYLHYVPR
110 120 130 140 150
KFDEWVAPTP EVADMQNHLH RSVFLTFLRM STHKESKDHF ISPSAFGEIL
160 170 180 190 200
YNNFLFDIPK ILDLCVLFGK GNSPLLQKMI GNIFTQQPSY YTDLDETIPT
210 220 230 240 250
ILQVFSNILQ HCGLQGDGTS TTPQKLGERS PLTPSDMPLL ELKDIVLYLC
260 270 280 290 300
DTSTTLWAFL DIFPLACQTF QKHDFCYRLA SFYEMAIPEL ESAIKKRRLE
310 320 330 340 350
DSKLLGDMWQ RLSHSKKKLM EVFHIILNQI CLLPILESSC DNIQGFIEEF
360 370 380 390 400
LQIFSSLLQE KRFLRDYDTF SPVAEDISLL QQASSALDET RTAYILQAVE
410 420 430 440 450
SAWEGVDRQK IKDIKDPPRA KGSNNEVTVT AEPVSEMPSQ LENLEEDEEC
460 470 480 490 500
MGAAAALGPA VSGVELDSLI SQVKDLLPDL GEGFILACLE HYSYDSEQVI
510 520 530 540 550
NNILEDRLAP ELSQLDRGLE RQVKPDPTPL LSSRHNIFQN DEFDVFSRDS
560 570 580 590 600
VDLSRVHKGR RKEENVRSLV NDKQAVVAQW QRYQKYSVVV EEVPLQPGEY
610 620 630 640 650
QADDYEDEYD DTYDGNQVGA NDADSDDELI SRRPFTIPQV LRTKMPGEVQ
660 670 680 690 700
EEEWDEEDEV EEEAPKPDHF IQDPAVLREK AEARRMAFLA RKGYRPENST
710 720 730 740
AVTGGPRGHG QSRETTQERR KKEANKAARA NHNRRTMADR KRSKGMIPS
Length:749
Mass (Da):85,653
Last modified:December 1, 2001 - v1
Checksum:i9923D4BE00B7C3AB
GO
Isoform 2 (identifier: Q91WR3-2) [UniParc]FASTAAdd to basket

Also known as: 100S

The sequence of this isoform differs from the canonical sequence as follows:
     522-561: Missing.

Show »
Length:709
Mass (Da):80,976
Checksum:iA4FE31AA6E9B3BA6
GO
Isoform 3 (identifier: Q91WR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     733-749: NRRTMADRKRSKGMIPS → KSFCAPEMDYERPEGLRRGAELAVCPWCLSSGCVCPC

Note: Incomplete sequence.
Show »
Length:769
Mass (Da):87,713
Checksum:i47B08C3AF9548238
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei522 – 56140Missing in isoform 2. 1 PublicationVSP_011012Add
BLAST
Alternative sequencei733 – 74917NRRTM…GMIPS → KSFCAPEMDYERPEGLRRGA ELAVCPWCLSSGCVCPC in isoform 3. CuratedVSP_011013Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048876 mRNA. Translation: BAC33480.1.
AK051387 mRNA. Translation: BAC34621.1.
AL606521 Genomic DNA. Translation: CAI35279.1.
BC013537 mRNA. Translation: AAH13537.1.
BC024840 mRNA. Translation: AAH24840.1.
CCDSiCCDS24387.1. [Q91WR3-1]
RefSeqiNP_083567.1. NM_029291.1. [Q91WR3-1]
UniGeneiMm.439906.

Genome annotation databases

EnsembliENSMUST00000070257; ENSMUSP00000063272; ENSMUSG00000020412. [Q91WR3-1]
ENSMUST00000109930; ENSMUSP00000105556; ENSMUSG00000020412. [Q91WR3-2]
GeneIDi75452.
KEGGimmu:75452.
UCSCiuc007hva.2. mouse. [Q91WR3-1]
uc011xqz.2. mouse. [Q91WR3-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048876 mRNA. Translation: BAC33480.1.
AK051387 mRNA. Translation: BAC34621.1.
AL606521 Genomic DNA. Translation: CAI35279.1.
BC013537 mRNA. Translation: AAH13537.1.
BC024840 mRNA. Translation: AAH24840.1.
CCDSiCCDS24387.1. [Q91WR3-1]
RefSeqiNP_083567.1. NM_029291.1. [Q91WR3-1]
UniGeneiMm.439906.

3D structure databases

ProteinModelPortaliQ91WR3.
SMRiQ91WR3. Positions 463-523.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000063272.

PTM databases

iPTMnetiQ91WR3.
PhosphoSiteiQ91WR3.

Proteomic databases

EPDiQ91WR3.
MaxQBiQ91WR3.
PaxDbiQ91WR3.
PRIDEiQ91WR3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000070257; ENSMUSP00000063272; ENSMUSG00000020412. [Q91WR3-1]
ENSMUST00000109930; ENSMUSP00000105556; ENSMUSG00000020412. [Q91WR3-2]
GeneIDi75452.
KEGGimmu:75452.
UCSCiuc007hva.2. mouse. [Q91WR3-1]
uc011xqz.2. mouse. [Q91WR3-2]

Organism-specific databases

CTDi84164.
MGIiMGI:1922702. Ascc2.

Phylogenomic databases

eggNOGiKOG4501. Eukaryota.
ENOG410XSUE. LUCA.
GeneTreeiENSGT00390000018806.
HOGENOMiHOG000234347.
HOVERGENiHBG050589.
InParanoidiQ91WR3.
KOiK18667.
OMAiMNQICLL.
OrthoDBiEOG708VZP.
PhylomeDBiQ91WR3.
TreeFamiTF323459.

Miscellaneous databases

ChiTaRSiAscc2. mouse.
PMAP-CutDBQ91WR3.
PROiQ91WR3.
SOURCEiSearch...

Gene expression databases

BgeeiQ91WR3.
GenevisibleiQ91WR3. MM.

Family and domain databases

InterProiIPR003892. CUE.
IPR009060. UBA-like.
[Graphical view]
PfamiPF02845. CUE. 1 hit.
[Graphical view]
SMARTiSM00546. CUE. 1 hit.
[Graphical view]
SUPFAMiSSF46934. SSF46934. 1 hit.
PROSITEiPS51140. CUE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Eye and Spinal ganglion.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Eye and Kidney.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver, Pancreas and Spleen.

Entry informationi

Entry nameiASCC2_MOUSE
AccessioniPrimary (citable) accession number: Q91WR3
Secondary accession number(s): Q5NCK1
, Q8BKM9, Q8BX60, Q8R1B9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: December 1, 2001
Last modified: June 8, 2016
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.