Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Threonylcarbamoyladenosine tRNA methylthiotransferase

Gene

Cdkal1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t6A), leading to the formation of 2-methylthio-N6-threonylcarbamoyladenosine (ms2t6A) at position 37 in tRNAs that read codons beginning with adenine.By similarity

Catalytic activityi

N(6)-L-threonylcarbamoyladenine(37) in tRNA + sulfur-(sulfur carrier) + 2 S-adenosyl-L-methionine + reduced electron acceptor = 2-methylthio-N(6)-L-threonylcarbamoyladenine(37) in tRNA + S-adenosyl-L-homocysteine + (sulfur carrier) + L-methionine + 5'-deoxyadenosine + electron acceptor.By similarity

Cofactori

[4Fe-4S] clusterPROSITE-ProRule annotationNote: Binds 2 [4Fe-4S] clusters. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi72 – 721Iron-sulfur (4Fe-4S)PROSITE-ProRule annotation
Metal bindingi108 – 1081Iron-sulfur (4Fe-4S)PROSITE-ProRule annotation
Metal bindingi137 – 1371Iron-sulfur (4Fe-4S)PROSITE-ProRule annotation
Metal bindingi213 – 2131Iron-sulfur (4Fe-4S-S-AdoMet)PROSITE-ProRule annotation
Metal bindingi217 – 2171Iron-sulfur (4Fe-4S-S-AdoMet)PROSITE-ProRule annotation
Metal bindingi220 – 2201Iron-sulfur (4Fe-4S-S-AdoMet)PROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

  • maintenance of translational fidelity Source: MGI
  • tRNA methylthiolation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

tRNA processing

Keywords - Ligandi

4Fe-4S, Iron, Iron-sulfur, Metal-binding, S-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
Threonylcarbamoyladenosine tRNA methylthiotransferase (EC:2.8.4.5)
Alternative name(s):
CDK5 regulatory subunit-associated protein 1-like 1
tRNA-t(6)A37 methylthiotransferase
Gene namesi
Name:Cdkal1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1921765. Cdkal1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei553 – 57018HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

  • endoplasmic reticulum Source: MGI
  • endoplasmic reticulum membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: MGI
  • rough endoplasmic reticulum Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 578578Threonylcarbamoyladenosine tRNA methylthiotransferasePRO_0000298671Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei121 – 1211PhosphoserineBy similarity
Modified residuei498 – 4981PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ91WE6.
MaxQBiQ91WE6.
PaxDbiQ91WE6.
PeptideAtlasiQ91WE6.
PRIDEiQ91WE6.

PTM databases

iPTMnetiQ91WE6.
PhosphoSiteiQ91WE6.

Expressioni

Tissue specificityi

Expressed in pancreas, liver and skeletal muscle, especially in white muscle fibers.1 Publication

Gene expression databases

BgeeiQ91WE6.
ExpressionAtlasiQ91WE6. baseline and differential.
GenevisibleiQ91WE6. MM.

Interactioni

Protein-protein interaction databases

IntActiQ91WE6. 1 interaction.
STRINGi10090.ENSMUSP00000006353.

Structurei

3D structure databases

ProteinModelPortaliQ91WE6.
SMRiQ91WE6. Positions 64-493.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini63 – 171109MTTase N-terminalPROSITE-ProRule annotationAdd
BLAST
Domaini430 – 49263TRAMPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 MTTase N-terminal domain.PROSITE-ProRule annotation
Contains 1 TRAM domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4355. Eukaryota.
COG0621. LUCA.
GeneTreeiENSGT00530000063447.
HOGENOMiHOG000224768.
HOVERGENiHBG097712.
InParanoidiQ91WE6.
KOiK15865.
OMAiDLFYSYE.
OrthoDBiEOG7SFHWS.
PhylomeDBiQ91WE6.
TreeFamiTF317476.

Family and domain databases

Gene3Di3.80.30.20. 1 hit.
InterProiIPR006638. Elp3/MiaB/NifB.
IPR023970. MeThioTfrase/rSAM.
IPR005839. Methylthiotransferase.
IPR020612. Methylthiotransferase_CS.
IPR013848. Methylthiotransferase_N.
IPR006466. MiaB-like_B.
IPR007197. rSAM.
IPR023404. rSAM_horseshoe.
IPR002792. TRAM_dom.
[Graphical view]
PANTHERiPTHR11918. PTHR11918. 1 hit.
PfamiPF04055. Radical_SAM. 1 hit.
PF01938. TRAM. 1 hit.
PF00919. UPF0004. 1 hit.
[Graphical view]
SMARTiSM00729. Elp3. 1 hit.
[Graphical view]
TIGRFAMsiTIGR01578. MiaB-like-B. 1 hit.
TIGR00089. TIGR00089. 1 hit.
PROSITEiPS51449. MTTASE_N. 1 hit.
PS01278. MTTASE_RADICAL. 1 hit.
PS50926. TRAM. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q91WE6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSASCDVLL DDIEDIISQE DSKPQDRQFS RKHVFPKVRR RNTQKYLQEE
60 70 80 90 100
PRPPSDSTIP GIQKIWIRTW GCSHNNSDGE YMAGQLAAYG YKITENASDA
110 120 130 140 150
DLWLLNSCTV KNPAEDHFRN SIKKAQEENK KVVLAGCVPQ AQPRQDYLKG
160 170 180 190 200
LSIIGVQQID RVVEVVEETI KGHSVRLLGQ KKDNGKRLGG ARLDLPKIRK
210 220 230 240 250
NPLIEIISIN TGCLNACTYC KTKHARGNLA SYPIDELVER AKQSFQEGVC
260 270 280 290 300
EIWLTSEDTG AYGRDIGTDL PTLLWKLVEV IPEGAMLRLG MTNPPYILEH
310 320 330 340 350
LEEMAKILNH PRVYAFLHIP VQSASDSVLM DMKREYCVAD FKRVVDFLKE
360 370 380 390 400
KVPGITIATD IICGFPGETD QDFQETVKLV EEYKFPSLFI NQFYPRPGTP
410 420 430 440 450
AAKAEQVPAH VKKQRTKDLS RVFHSYNPYD HKIGERQQVL VTEESFDSKF
460 470 480 490 500
YVAHNRFYEQ VLVPKNPAFM GKMVEVDIYE SGKHFLKGQP VSETRVYTPS
510 520 530 540 550
ISKPLAKGEV SGLTKEFRNR LGNHPNGTSD TCPATQHGSA YSRMVLQMSQ
560 570
YDCALKVATG LALLALLLHF WPDSLLTM
Length:578
Mass (Da):65,289
Last modified:December 1, 2001 - v1
Checksum:i293F451812B51D50
GO
Isoform 2 (identifier: Q91WE6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     516-578: EFRNRLGNHPNGTSDTCPATQHGSAYSRMVLQMSQYDCALKVATGLALLALLLHFWPDSLLTM → ALDYL

Show »
Length:520
Mass (Da):58,918
Checksum:iECDAEF3E9BE336E3
GO
Isoform 3 (identifier: Q91WE6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     352-578: Missing.

Show »
Length:351
Mass (Da):39,734
Checksum:i5E61BC62831ACB77
GO
Isoform 4 (identifier: Q91WE6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-360: Missing.
     366-366: P → L
     367-578: Missing.

Show »
Length:218
Mass (Da):24,548
Checksum:i6B52F94153E45AF6
GO
Isoform 5 (identifier: Q91WE6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-135: ENASDADLWL...QEENKKVVLA → AQSGTESSLG...TPLILLVVWW
     136-578: Missing.

Show »
Length:136
Mass (Da):15,558
Checksum:i6952356860CA0D3E
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei95 – 13541ENASD…KVVLA → AQSGTESSLGAMELIHHPVR TVLHSVRCRVLKTPLILLVV WW in isoform 5. 1 PublicationVSP_027454Add
BLAST
Alternative sequencei136 – 578443Missing in isoform 5. 1 PublicationVSP_027455Add
BLAST
Alternative sequencei213 – 360148Missing in isoform 4. 1 PublicationVSP_027456Add
BLAST
Alternative sequencei352 – 578227Missing in isoform 3. 1 PublicationVSP_027457Add
BLAST
Alternative sequencei366 – 3661P → L in isoform 4. 1 PublicationVSP_027458
Alternative sequencei367 – 578212Missing in isoform 4. 1 PublicationVSP_027459Add
BLAST
Alternative sequencei516 – 57863EFRNR…SLLTM → ALDYL in isoform 2. 1 PublicationVSP_027460Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004490 mRNA. Translation: BAB23330.1.
AK041864 mRNA. Translation: BAE20608.1.
AK045506 mRNA. Translation: BAE43325.1.
AK082629 mRNA. Translation: BAC38554.1.
AK169761 mRNA. Translation: BAE41351.1.
AL513025
, AL512647, AL589701, AL645587 Genomic DNA. Translation: CAI24677.1.
AL512647
, AL513025, AL589701, AL645587 Genomic DNA. Translation: CAI25816.1.
AL645587
, AL512647, AL513025, AL589701 Genomic DNA. Translation: CAI35144.1.
AL589701
, AL512647, AL513025, AL645587 Genomic DNA. Translation: CAI35240.1.
AL513025 Genomic DNA. Translation: CAI24675.1.
BC016073 mRNA. Translation: AAH16073.1.
CCDSiCCDS26412.1. [Q91WE6-1]
RefSeqiNP_001295415.1. NM_001308486.1. [Q91WE6-5]
NP_653119.1. NM_144536.3. [Q91WE6-1]
UniGeneiMm.212227.

Genome annotation databases

EnsembliENSMUST00000006353; ENSMUSP00000006353; ENSMUSG00000006191. [Q91WE6-1]
ENSMUST00000091674; ENSMUSP00000089262; ENSMUSG00000006191. [Q91WE6-5]
ENSMUST00000137225; ENSMUSP00000117404; ENSMUSG00000006191. [Q91WE6-4]
ENSMUST00000140278; ENSMUSP00000122249; ENSMUSG00000006191. [Q91WE6-2]
GeneIDi68916.
KEGGimmu:68916.
UCSCiuc007pyn.1. mouse. [Q91WE6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004490 mRNA. Translation: BAB23330.1.
AK041864 mRNA. Translation: BAE20608.1.
AK045506 mRNA. Translation: BAE43325.1.
AK082629 mRNA. Translation: BAC38554.1.
AK169761 mRNA. Translation: BAE41351.1.
AL513025
, AL512647, AL589701, AL645587 Genomic DNA. Translation: CAI24677.1.
AL512647
, AL513025, AL589701, AL645587 Genomic DNA. Translation: CAI25816.1.
AL645587
, AL512647, AL513025, AL589701 Genomic DNA. Translation: CAI35144.1.
AL589701
, AL512647, AL513025, AL645587 Genomic DNA. Translation: CAI35240.1.
AL513025 Genomic DNA. Translation: CAI24675.1.
BC016073 mRNA. Translation: AAH16073.1.
CCDSiCCDS26412.1. [Q91WE6-1]
RefSeqiNP_001295415.1. NM_001308486.1. [Q91WE6-5]
NP_653119.1. NM_144536.3. [Q91WE6-1]
UniGeneiMm.212227.

3D structure databases

ProteinModelPortaliQ91WE6.
SMRiQ91WE6. Positions 64-493.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ91WE6. 1 interaction.
STRINGi10090.ENSMUSP00000006353.

PTM databases

iPTMnetiQ91WE6.
PhosphoSiteiQ91WE6.

Proteomic databases

EPDiQ91WE6.
MaxQBiQ91WE6.
PaxDbiQ91WE6.
PeptideAtlasiQ91WE6.
PRIDEiQ91WE6.

Protocols and materials databases

DNASUi68916.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000006353; ENSMUSP00000006353; ENSMUSG00000006191. [Q91WE6-1]
ENSMUST00000091674; ENSMUSP00000089262; ENSMUSG00000006191. [Q91WE6-5]
ENSMUST00000137225; ENSMUSP00000117404; ENSMUSG00000006191. [Q91WE6-4]
ENSMUST00000140278; ENSMUSP00000122249; ENSMUSG00000006191. [Q91WE6-2]
GeneIDi68916.
KEGGimmu:68916.
UCSCiuc007pyn.1. mouse. [Q91WE6-1]

Organism-specific databases

CTDi54901.
MGIiMGI:1921765. Cdkal1.

Phylogenomic databases

eggNOGiKOG4355. Eukaryota.
COG0621. LUCA.
GeneTreeiENSGT00530000063447.
HOGENOMiHOG000224768.
HOVERGENiHBG097712.
InParanoidiQ91WE6.
KOiK15865.
OMAiDLFYSYE.
OrthoDBiEOG7SFHWS.
PhylomeDBiQ91WE6.
TreeFamiTF317476.

Miscellaneous databases

PROiQ91WE6.
SOURCEiSearch...

Gene expression databases

BgeeiQ91WE6.
ExpressionAtlasiQ91WE6. baseline and differential.
GenevisibleiQ91WE6. MM.

Family and domain databases

Gene3Di3.80.30.20. 1 hit.
InterProiIPR006638. Elp3/MiaB/NifB.
IPR023970. MeThioTfrase/rSAM.
IPR005839. Methylthiotransferase.
IPR020612. Methylthiotransferase_CS.
IPR013848. Methylthiotransferase_N.
IPR006466. MiaB-like_B.
IPR007197. rSAM.
IPR023404. rSAM_horseshoe.
IPR002792. TRAM_dom.
[Graphical view]
PANTHERiPTHR11918. PTHR11918. 1 hit.
PfamiPF04055. Radical_SAM. 1 hit.
PF01938. TRAM. 1 hit.
PF00919. UPF0004. 1 hit.
[Graphical view]
SMARTiSM00729. Elp3. 1 hit.
[Graphical view]
TIGRFAMsiTIGR01578. MiaB-like-B. 1 hit.
TIGR00089. TIGR00089. 1 hit.
PROSITEiPS51449. MTTASE_N. 1 hit.
PS01278. MTTASE_RADICAL. 1 hit.
PS50926. TRAM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Strain: C57BL/6J and NOD.
    Tissue: Cerebellum and Thymus.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.
  4. "CDK5 regulatory subunit associated protein 1-like 1 (CDKAL1) is a tail-anchored protein in the endoplasmic reticulum (ER) of insulinoma cells."
    Brambillasca S., Altkrueger A., Colombo S., Friedrich A., Eickelmann P., Mark M., Borgese N., Solimena M.
    J. Biol. Chem. 287:41808-41819(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiCDKAL_MOUSE
AccessioniPrimary (citable) accession number: Q91WE6
Secondary accession number(s): Q3TE97
, Q3V3D2, Q5T0I5, Q8C4B0, Q9CT69
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: December 1, 2001
Last modified: July 6, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.