Q91V12 (BACH_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytosolic acyl coenzyme A thioester hydrolase EC=3.1.2.2 Alternative name(s): Acyl-CoA thioesterase 7 Brain acyl-CoA hydrolase Short name=BACH CTE-IIa Short name=CTE-II Long chain acyl-CoA thioester hydrolase | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 381 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. Has a maximal activity toward palmitoyl-CoA. Ref.2 |
| Catalytic activity | Palmitoyl-CoA + H2O = CoA + palmitate. |
| Subunit structure | Homohexamer. Ref.9 |
| Subcellular location | |
| Tissue specificity | Widely expressed with highest levels in brain. High levels also found in thymus, large intestine and testis. Negligible in muscle and adipose tissue. In the central and peripheral nervous systems, displays a predominantly neuronal localization with highest expression in cell bodies and neurites. Ref.2 |
| Developmental stage | Detected in the brain as early as embryonic day (E) 11.5. The level was low until E12.5, but promptly elevated to a peak 7 days after birth. Thereafter, it declined somewhat and reached a steady-state level in adulthood. These changes in BACH expression were approximately reflected in the palmitoyl-CoA hydrolyzing activity in the developing mouse brain, and the time course was quite similar to that of microtubule-associated protein 2 (MAP2) expression. Induced during embryogenesis in association with neuronal differentiation, and persists after terminal differentiation into neurons in postnatal stages, resulting in the constitutive high expression of BACH in the adult brain in a neuron-specific manner. Ref.8 |
| Induction | Up-Regulated in activated macrophages. Ref.9 |
| Domain | Both hydrolase domains are required for efficient activity. |
| Sequence similarities | Contains 2 acyl coenzyme A hydrolase domains. |
| Biophysicochemical properties | Kinetic parameters: KM=16 µM for palmitoyl-CoA (isoform A at 30 degrees Celsius) Ref.3 KM=12 µM for palmitoyl-CoA (isoform D at 30 degrees Celsius) |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Molecular function | Hydrolase Serine esterase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | fatty acid catabolic process Inferred from direct assay Ref.2. Source: MGI |
| Cellular component | cell body Inferred from direct assay Ref.2. Source: MGI cytosolInferred from direct assay Ref.2. Source: MGI neuron projectionInferred from direct assay Ref.2. Source: MGI |
| Molecular function | carboxylesterase activity Inferred from electronic annotation. Source: UniProtKB-KW palmitoyl-CoA hydrolase activityInferred from direct assay Ref.2. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: Q91V12-1) Also known as: mBACHb; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: Q91V12-2) Also known as: mBach; mBACHa; 43-kDa BACH; The sequence of this isoform differs from the canonical sequence as follows: 1-58: MKLLVGTLRLWEVGRQVAFSSLTPGQECSGLRKTFWAAMRAVRTRADHQKLGHCVTMG → MSGPTTDTPAAIQIC | ||||||
| Note: Major isoform. | ||||||
| Isoform C (identifier: Q91V12-3) Also known as: mBACHc; The sequence of this isoform differs from the canonical sequence as follows: 1-59: MKLLVGTLRL...KLGHCVTMGR → MLTLHRALALRVLRKEVTEAYLREKVKQ | ||||||
| Isoform D (identifier: Q91V12-4) Also known as: 50-kDa BACH; The sequence of this isoform differs from the canonical sequence as follows: 1-58: MKLLVGTLRL...QKLGHCVTMG → MAPPLPSSSM...TDTPAAIQIC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 381 | 381 | Cytosolic acyl coenzyme A thioester hydrolase | PRO_0000053807 | ||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||
| Domain | 57 – 152 | 96 | Acyl coenzyme A hydrolase 1 | |||||||||||||||||||||||||||||||||||||||||
| Domain | 243 – 320 | 78 | Acyl coenzyme A hydrolase 2 | |||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||
| Active site | 67 | 1 | Ref.9 | |||||||||||||||||||||||||||||||||||||||||
| Active site | 256 | 1 | Ref.9 | |||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 79 | 1 | N6-acetyllysine By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 169 | 1 | N6-acetyllysine By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 199 | 1 | N6-acetyllysine By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 284 | 1 | N6-acetyllysine By similarity | |||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 59 | 59 | MKLLV…VTMGR → MLTLHRALALRVLRKEVTEA YLREKVKQ in isoform C. | VSP_000157 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 58 | 58 | MKLLV…CVTMG → MSGPTTDTPAAIQIC in isoform A. | VSP_000158 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 58 | 58 | MKLLV…CVTMG → MAPPLPSSSMAPPRLIHSGT GLLDTCSQIPPPPPSSAVAA KMSGPTTDTPAAIQIC in isoform D. | VSP_016955 | ||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 67 | 1 | N → A: Dramatic reduction in catalytic activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 256 | 1 | D → A: Dramatic reduction in catalytic activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 186 | 1 | E → D in BAE31092. Ref.4 | |||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 63 – 65 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 72 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 74 – 93 | 20 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 94 – 96 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 101 – 108 | 8 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 122 – 132 | 11 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 137 – 146 | 10 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 148 – 150 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 153 – 170 | 18 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 185 – 201 | 17 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 224 – 227 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 229 – 234 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 248 – 267 | 20 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 272 – 281 | 10 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 289 – 301 | 13 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 304 – 316 | 13 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 324 – 334 | 11 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 353 – 367 | 15 | ||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human brain acyl-CoA hydrolase isoforms encoded by a single gene." Yamada J., Kuramochi Y., Takagi M., Watanabe T., Suga T. Biochem. Biophys. Res. Commun. 299:49-56(2002) [PubMed: 12435388] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B AND C). Strain: ICR. Tissue: Brain. |
| [2] | "Characterization of mouse homolog of brain acyl-CoA hydrolase: molecular cloning and neuronal localization." Kuramochi Y., Takagi-Sakuma M., Kitahara M., Emori R., Asaba Y., Sakaguchi R., Watanabe T., Kuroda J., Hiratsuka K., Nagae Y., Suga T., Yamada J. Brain Res. Mol. Brain Res. 98:81-92(2002) [PubMed: 11834298] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING. Strain: ICR. Tissue: Brain. |
| [3] | "A 50-kDa isoform of mouse brain acyl-CoA hydrolase: expression and molecular properties." Takagi M., Kawabe K., Suga T., Yamada J. Arch. Biochem. Biophys. 429:100-105(2004) [PubMed: 15288813] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D), BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION. Strain: ICR. Tissue: Brain. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Strain: C57BL/6J. Tissue: Bone marrow. |
| [5] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Colon. |
| [7] | Lubec G., Klug S., Yang J.W., Zigmond M. Submitted (JUL-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 174-184 AND 269-284, MASS SPECTROMETRY. Tissue: Brain and Hippocampus. |
| [8] | "Expression of acyl-CoA hydrolase in the developing mouse brain." Yamada J., Kuramochi Y., Takagi M., Suga T. Neurosci. Lett. 355:89-92(2004) [PubMed: 14729242] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [9] | "Structural basis for recruitment of tandem hotdog domains in acyl-CoA thioesterase 7 and its role in inflammation." Forwood J.K., Thakur A.S., Guncar G., Marfori M., Mouradov D., Meng W., Robinson J., Huber T., Kellie S., Martin J.L., Hume D.A., Kobe B. Proc. Natl. Acad. Sci. U.S.A. 104:10382-10387(2007) [PubMed: 17563367] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 203-381, X-RAY CRYSTALLOGRAPHY (1.78 ANGSTROMS) OF 59-206 (ISOFORM A), SUBUNIT, INDUCTION, MUTAGENESIS OF ASN-67 AND ASP-256, ACTIVE SITE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB088411 mRNA. Translation: BAC20217.1. AB088412 mRNA. Translation: BAC20218.1. AB049821 mRNA. Translation: BAB61731.1. AB207243 mRNA. Translation: BAD91166.1. AK152277 mRNA. Translation: BAE31092.1. AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19695.1. AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19696.1. AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19698.1. AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23900.1. AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23901.1. AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23903.1. AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26444.1. AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26445.1. AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26446.1. BC013507 mRNA. Translation: AAH13507.1. | ||||||||||||||||||
| IPI | IPI00125939. IPI00230588. IPI00284094. IPI00672508. | ||||||||||||||||||
| RefSeq | NP_001139529.1. NM_001146057.1. NP_001139530.1. NM_001146058.1. NP_579926.2. NM_133348.2. | ||||||||||||||||||
| UniGene | Mm.296191. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q91V12. | ||||||||||||||||||
| SMR | Q91V12. Positions 52-376. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q91V12. 1 interaction. | ||||||||||||||||||
| STRING | Q91V12. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q91V12. | ||||||||||||||||||
2D gel databases | |||||||||||||||||||
| REPRODUCTION-2DPAGE | Q91V12. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q91V12. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSMUST00000030779; ENSMUSP00000030779; ENSMUSG00000028937. ENSMUST00000075363; ENSMUSP00000074827; ENSMUSG00000028937. ENSMUST00000105652; ENSMUSP00000101277; ENSMUSG00000028937. | ||||||||||||||||||
| GeneID | 70025. | ||||||||||||||||||
| KEGG | mmu:70025. | ||||||||||||||||||
| UCSC | uc008vzx.2. mouse. uc008vzy.2. mouse. uc008vzz.2. mouse. uc008waa.2. mouse. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 11332. | ||||||||||||||||||
| MGI | MGI:1917275. Acot7. | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | roNOG15499. | ||||||||||||||||||
| GeneTree | ENSGT00390000000934. | ||||||||||||||||||
| HOGENOM | HBG447008. | ||||||||||||||||||
| HOVERGEN | HBG036928. | ||||||||||||||||||
| InParanoid | Q91V12. | ||||||||||||||||||
| OMA | KVTNKAT. | ||||||||||||||||||
| OrthoDB | EOG4JWVF5. | ||||||||||||||||||
| PhylomeDB | Q91V12. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 3.1.2.2. 3474. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q91V12. | ||||||||||||||||||
| Bgee | Q91V12. | ||||||||||||||||||
| CleanEx | MM_ACOT7. | ||||||||||||||||||
| Genevestigator | Q91V12. | ||||||||||||||||||
| GermOnline | ENSMUSG00000028937. Mus musculus. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR006683. Thioestr_supf. [Graphical view] | ||||||||||||||||||
| KO | K01068. | ||||||||||||||||||
| Pfam | PF03061. 4HBT. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 330849. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | BACH_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q91V12 Secondary accession number(s): A2A8K9 Q59HQ2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with