Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic acyl coenzyme A thioester hydrolase

Gene

Acot7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. Has a maximal activity toward palmitoyl-CoA.1 Publication

Catalytic activityi

Palmitoyl-CoA + H2O = CoA + palmitate.

Kineticsi

  1. KM=16 µM for palmitoyl-CoA (isoform A at 30 degrees Celsius)1 Publication
  2. KM=12 µM for palmitoyl-CoA (isoform D at 30 degrees Celsius)1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Active sitei671 Publication1
    Active sitei2561 Publication1

    GO - Molecular functioni

    GO - Biological processi

    Complete GO annotation...

    Keywords - Molecular functioni

    Hydrolase, Serine esterase

    Enzyme and pathway databases

    BRENDAi3.1.2.2. 3474.
    ReactomeiR-MMU-75105. Fatty Acyl-CoA Biosynthesis.
    SABIO-RKQ91V12.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytosolic acyl coenzyme A thioester hydrolase (EC:3.1.2.2)
    Alternative name(s):
    Acyl-CoA thioesterase 7
    Brain acyl-CoA hydrolase
    Short name:
    BACH
    CTE-IIa
    Short name:
    CTE-II
    Long chain acyl-CoA thioester hydrolase
    Gene namesi
    Name:Acot7
    Synonyms:Bach
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    Proteomesi
    • UP000000589 Componenti: Chromosome 4

    Organism-specific databases

    MGIiMGI:1917275. Acot7.

    Subcellular locationi

    GO - Cellular componenti

    • cell body Source: MGI
    • cytoplasm Source: MGI
    • cytosol Source: MGI
    • extracellular exosome Source: MGI
    • neuron projection Source: MGI
    • nucleoplasm Source: MGI
    Complete GO annotation...

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Mutagenesisi67N → A: Dramatic reduction in catalytic activity. 1 Publication1
    Mutagenesisi256D → A: Dramatic reduction in catalytic activity. 1 Publication1

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00000538071 – 381Cytosolic acyl coenzyme A thioester hydrolaseAdd BLAST381

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei169N6-acetyllysineBy similarity1
    Modified residuei199N6-acetyllysineBy similarity1
    Modified residuei284N6-acetyllysineBy similarity1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    PaxDbiQ91V12.
    PeptideAtlasiQ91V12.
    PRIDEiQ91V12.

    2D gel databases

    REPRODUCTION-2DPAGEQ91V12.

    PTM databases

    iPTMnetiQ91V12.
    PhosphoSitePlusiQ91V12.
    SwissPalmiQ91V12.

    Expressioni

    Tissue specificityi

    Widely expressed with highest levels in brain. High levels also found in thymus, large intestine and testis. Negligible in muscle and adipose tissue. In the central and peripheral nervous systems, displays a predominantly neuronal localization with highest expression in cell bodies and neurites.1 Publication

    Developmental stagei

    Detected in the brain as early as embryonic day (E) 11.5. The level was low until E12.5, but promptly elevated to a peak 7 days after birth. Thereafter, it declined somewhat and reached a steady-state level in adulthood. These changes in BACH expression were approximately reflected in the palmitoyl-CoA hydrolyzing activity in the developing mouse brain, and the time course was quite similar to that of microtubule-associated protein 2 (MAP2) expression. Induced during embryogenesis in association with neuronal differentiation, and persists after terminal differentiation into neurons in postnatal stages, resulting in the constitutive high expression of BACH in the adult brain in a neuron-specific manner.1 Publication

    Inductioni

    Up-Regulated in activated macrophages.1 Publication

    Gene expression databases

    BgeeiENSMUSG00000028937.
    CleanExiMM_ACOT7.
    ExpressionAtlasiQ91V12. baseline and differential.
    GenevisibleiQ91V12. MM.

    Interactioni

    Subunit structurei

    Homohexamer.1 Publication

    GO - Molecular functioni

    Protein-protein interaction databases

    BioGridi213825. 1 interactor.
    DIPiDIP-54691N.
    IntActiQ91V12. 3 interactors.
    MINTiMINT-4089008.
    STRINGi10090.ENSMUSP00000129121.

    Structurei

    Secondary structure

    1381
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Helixi63 – 65Combined sources3
    Beta strandi70 – 72Combined sources3
    Helixi74 – 93Combined sources20
    Turni94 – 96Combined sources3
    Beta strandi101 – 108Combined sources8
    Beta strandi122 – 132Combined sources11
    Beta strandi137 – 146Combined sources10
    Turni148 – 150Combined sources3
    Beta strandi153 – 170Combined sources18
    Helixi185 – 201Combined sources17
    Helixi224 – 227Combined sources4
    Beta strandi229 – 234Combined sources6
    Helixi237 – 239Combined sources3
    Beta strandi242 – 246Combined sources5
    Helixi248 – 267Combined sources20
    Beta strandi272 – 281Combined sources10
    Beta strandi289 – 301Combined sources13
    Beta strandi304 – 316Combined sources13
    Beta strandi324 – 334Combined sources11
    Beta strandi340 – 342Combined sources3
    Helixi353 – 367Combined sources15

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2Q2BX-ray2.50A/B203-381[»]
    2V1OX-ray1.78A/B/C/D/E/F59-206[»]
    4ZV3X-ray3.10A/B/C55-369[»]
    ProteinModelPortaliQ91V12.
    SMRiQ91V12.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ91V12.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Domaini51 – 169HotDog ACOT-type 1PROSITE-ProRule annotationAdd BLAST119
    Domaini225 – 339HotDog ACOT-type 2PROSITE-ProRule annotationAdd BLAST115

    Domaini

    Both HotDog ACOT-type hydrolase domains are required for efficient activity.

    Sequence similaritiesi

    Contains 2 HotDog ACOT-type domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiKOG2763. Eukaryota.
    COG1607. LUCA.
    GeneTreeiENSGT00760000119297.
    HOGENOMiHOG000007663.
    HOVERGENiHBG036928.
    InParanoidiQ91V12.
    KOiK17360.
    OMAiMFIGEVA.
    PhylomeDBiQ91V12.
    TreeFamiTF329579.

    Family and domain databases

    Gene3Di3.10.129.10. 2 hits.
    InterProiIPR033120. HOTDOG_ACOT.
    IPR029069. HotDog_dom.
    IPR006683. Thioestr_dom.
    [Graphical view]
    PfamiPF03061. 4HBT. 2 hits.
    [Graphical view]
    SUPFAMiSSF54637. SSF54637. 2 hits.
    PROSITEiPS51770. HOTDOG_ACOT. 2 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform B (identifier: Q91V12-1) [UniParc]FASTAAdd to basket
    Also known as: mBACHb

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MKLLVGTLRL WEVGRQVAFS SLTPGQECSG LRKTFWAAMR AVRTRADHQK
    60 70 80 90 100
    LGHCVTMGRI MRPDDANVAG NVHGGTILKM IEEAGAIIST RHCNSQNGER
    110 120 130 140 150
    CVAALARVER TDFLSPMCIG EVAHVSAEIT YTSKHSVEVQ VHVMSENILT
    160 170 180 190 200
    GTKKLTNKAT LWYVPLSLKN VDKVLEVPPI VYLRQEQEEE GRKRYEAQKL
    210 220 230 240 250
    ERMETKWRNG DIVQPVLNPE PNTVSYSQSS LIHLVGPSDC TLHGFVHGGV
    260 270 280 290 300
    TMKLMDEVAG IVAARHCKTN IVTASVDAIN FHDKIRKGCV ITISGRMTFT
    310 320 330 340 350
    SNKSMEIEVL VDADPVVDNS QKRYRAASAF FTYVSLNQEG KPMPVPQLVP
    360 370 380
    ETEDEKKRFE EGKGRYLQMK AKRQGHTEPQ P
    Length:381
    Mass (Da):42,537
    Last modified:February 12, 2003 - v2
    Checksum:i813852DBEB6834C4
    GO
    Isoform A (identifier: Q91V12-2) [UniParc]FASTAAdd to basket
    Also known as: mBach, mBACHa, 43-kDa BACH

    The sequence of this isoform differs from the canonical sequence as follows:
         1-58: MKLLVGTLRLWEVGRQVAFSSLTPGQECSGLRKTFWAAMRAVRTRADHQKLGHCVTMG → MSGPTTDTPAAIQIC

    Note: Major isoform.
    Show »
    Length:338
    Mass (Da):37,555
    Checksum:iE1DB2E445494D477
    GO
    Isoform C (identifier: Q91V12-3) [UniParc]FASTAAdd to basket
    Also known as: mBACHc

    The sequence of this isoform differs from the canonical sequence as follows:
         1-59: MKLLVGTLRL...KLGHCVTMGR → MLTLHRALALRVLRKEVTEAYLREKVKQ

    Show »
    Length:350
    Mass (Da):39,259
    Checksum:i306F06A966F6F40E
    GO
    Isoform D (identifier: Q91V12-4) [UniParc]FASTAAdd to basket
    Also known as: 50-kDa BACH

    The sequence of this isoform differs from the canonical sequence as follows:
         1-58: MKLLVGTLRL...QKLGHCVTMG → MAPPLPSSSM...TDTPAAIQIC

    Show »
    Length:379
    Mass (Da):41,616
    Checksum:i832431B7D412E6FC
    GO

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti186E → D in BAE31092 (PubMed:16141072).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0001571 – 59MKLLV…VTMGR → MLTLHRALALRVLRKEVTEA YLREKVKQ in isoform C. 1 PublicationAdd BLAST59
    Alternative sequenceiVSP_0001581 – 58MKLLV…CVTMG → MSGPTTDTPAAIQIC in isoform A. 3 PublicationsAdd BLAST58
    Alternative sequenceiVSP_0169551 – 58MKLLV…CVTMG → MAPPLPSSSMAPPRLIHSGT GLLDTCSQIPPPPPSSAVAA KMSGPTTDTPAAIQIC in isoform D. 1 PublicationAdd BLAST58

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB088411 mRNA. Translation: BAC20217.1.
    AB088412 mRNA. Translation: BAC20218.1.
    AB049821 mRNA. Translation: BAB61731.1.
    AB207243 mRNA. Translation: BAD91166.1.
    AK152277 mRNA. Translation: BAE31092.1.
    AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19695.1.
    AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19696.1.
    AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19698.1.
    AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23900.1.
    AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23901.1.
    AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23903.1.
    AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26444.1.
    AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26445.1.
    AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26446.1.
    BC013507 mRNA. Translation: AAH13507.1.
    CCDSiCCDS51390.1. [Q91V12-4]
    CCDS51392.1. [Q91V12-3]
    RefSeqiNP_001139529.1. NM_001146057.1.
    NP_001139530.1. NM_001146058.1. [Q91V12-3]
    NP_579926.2. NM_133348.2. [Q91V12-4]
    UniGeneiMm.296191.

    Genome annotation databases

    EnsembliENSMUST00000030779; ENSMUSP00000030779; ENSMUSG00000028937. [Q91V12-1]
    ENSMUST00000075363; ENSMUSP00000074827; ENSMUSG00000028937. [Q91V12-4]
    ENSMUST00000105652; ENSMUSP00000101277; ENSMUSG00000028937. [Q91V12-3]
    GeneIDi70025.
    KEGGimmu:70025.
    UCSCiuc008vzx.2. mouse. [Q91V12-4]
    uc008vzz.2. mouse. [Q91V12-3]
    uc008waa.2. mouse. [Q91V12-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB088411 mRNA. Translation: BAC20217.1.
    AB088412 mRNA. Translation: BAC20218.1.
    AB049821 mRNA. Translation: BAB61731.1.
    AB207243 mRNA. Translation: BAD91166.1.
    AK152277 mRNA. Translation: BAE31092.1.
    AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19695.1.
    AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19696.1.
    AL772240, AL611985, AL671869 Genomic DNA. Translation: CAM19698.1.
    AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23900.1.
    AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23901.1.
    AL611985, AL671869, AL772240 Genomic DNA. Translation: CAM23903.1.
    AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26444.1.
    AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26445.1.
    AL671869, AL611985, AL772240 Genomic DNA. Translation: CAM26446.1.
    BC013507 mRNA. Translation: AAH13507.1.
    CCDSiCCDS51390.1. [Q91V12-4]
    CCDS51392.1. [Q91V12-3]
    RefSeqiNP_001139529.1. NM_001146057.1.
    NP_001139530.1. NM_001146058.1. [Q91V12-3]
    NP_579926.2. NM_133348.2. [Q91V12-4]
    UniGeneiMm.296191.

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2Q2BX-ray2.50A/B203-381[»]
    2V1OX-ray1.78A/B/C/D/E/F59-206[»]
    4ZV3X-ray3.10A/B/C55-369[»]
    ProteinModelPortaliQ91V12.
    SMRiQ91V12.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi213825. 1 interactor.
    DIPiDIP-54691N.
    IntActiQ91V12. 3 interactors.
    MINTiMINT-4089008.
    STRINGi10090.ENSMUSP00000129121.

    PTM databases

    iPTMnetiQ91V12.
    PhosphoSitePlusiQ91V12.
    SwissPalmiQ91V12.

    2D gel databases

    REPRODUCTION-2DPAGEQ91V12.

    Proteomic databases

    PaxDbiQ91V12.
    PeptideAtlasiQ91V12.
    PRIDEiQ91V12.

    Protocols and materials databases

    DNASUi70025.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENSMUST00000030779; ENSMUSP00000030779; ENSMUSG00000028937. [Q91V12-1]
    ENSMUST00000075363; ENSMUSP00000074827; ENSMUSG00000028937. [Q91V12-4]
    ENSMUST00000105652; ENSMUSP00000101277; ENSMUSG00000028937. [Q91V12-3]
    GeneIDi70025.
    KEGGimmu:70025.
    UCSCiuc008vzx.2. mouse. [Q91V12-4]
    uc008vzz.2. mouse. [Q91V12-3]
    uc008waa.2. mouse. [Q91V12-2]

    Organism-specific databases

    CTDi11332.
    MGIiMGI:1917275. Acot7.

    Phylogenomic databases

    eggNOGiKOG2763. Eukaryota.
    COG1607. LUCA.
    GeneTreeiENSGT00760000119297.
    HOGENOMiHOG000007663.
    HOVERGENiHBG036928.
    InParanoidiQ91V12.
    KOiK17360.
    OMAiMFIGEVA.
    PhylomeDBiQ91V12.
    TreeFamiTF329579.

    Enzyme and pathway databases

    BRENDAi3.1.2.2. 3474.
    ReactomeiR-MMU-75105. Fatty Acyl-CoA Biosynthesis.
    SABIO-RKQ91V12.

    Miscellaneous databases

    EvolutionaryTraceiQ91V12.
    PROiQ91V12.
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSMUSG00000028937.
    CleanExiMM_ACOT7.
    ExpressionAtlasiQ91V12. baseline and differential.
    GenevisibleiQ91V12. MM.

    Family and domain databases

    Gene3Di3.10.129.10. 2 hits.
    InterProiIPR033120. HOTDOG_ACOT.
    IPR029069. HotDog_dom.
    IPR006683. Thioestr_dom.
    [Graphical view]
    PfamiPF03061. 4HBT. 2 hits.
    [Graphical view]
    SUPFAMiSSF54637. SSF54637. 2 hits.
    PROSITEiPS51770. HOTDOG_ACOT. 2 hits.
    [Graphical view]
    ProtoNetiSearch...

    Entry informationi

    Entry nameiBACH_MOUSE
    AccessioniPrimary (citable) accession number: Q91V12
    Secondary accession number(s): A2A8K9
    , A2A8L0, A2A8L2, Q3U8C6, Q59HQ2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 12, 2003
    Last sequence update: February 12, 2003
    Last modified: November 2, 2016
    This is version 134 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.