Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BDNF/NT-3 growth factors receptor

Gene

NTRK2

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems through regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. Receptor for BDNF/brain-derived neurotrophic factor and NTF4/neurotrophin-4. Alternatively can also bind NTF3/neurotrophin-3 which is less efficient in activating the receptor but regulates neuron survival through NTRK2. Upon ligand-binding, undergoes homodimerization, autophosphorylation and activation. Recruits, phosphorylates and/or activates several downstream effectors that regulate distinct overlapping signaling cascades. Activates the GRB2-Ras-MAPK cascade that regulates for instance neuronal differentiation including neurite outgrowth. Controls the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. Through the downstream protein kinase C-regulated pathways controls synaptic plasticity. Thereby, plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. Also regulates the transcription of genes involved in cell survival. Hence, it is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. May also play a role in neutrophin-dependent calcium signaling in glial cells.

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Enzyme regulationi

The neuronal activity and the influx of calcium positively regulate the kinase activity and the internalization of the receptor which are both important for active signaling. Regulated by NGFR that may control the internalization of the receptor. NGFR may also stimulate the activation by BDNF compared to NTF3 and NTF4. The formation of active receptors dimers able to fully transduce the ligand-mediated signal, may be negatively regulated by the formation of inactive heterodimers with the non-catalytic isoforms (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei568ATPPROSITE-ProRule annotation1
Active sitei672Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi540 – 548ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Differentiation, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.10.1. 1306.

Names & Taxonomyi

Protein namesi
Recommended name:
BDNF/NT-3 growth factors receptor (EC:2.7.10.1)
Alternative name(s):
Neurotrophic tyrosine kinase receptor type 2
TrkB tyrosine kinase
Short name:
Trk-B
Gene namesi
Name:NTRK2
Synonyms:TRKB
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Chromosome Z

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini32 – 426ExtracellularSequence analysisAdd BLAST395
Transmembranei427 – 450HelicalSequence analysisAdd BLAST24
Topological domaini451 – 818CytoplasmicSequence analysisAdd BLAST368

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 31By similarityAdd BLAST31
ChainiPRO_000001673032 – 818BDNF/NT-3 growth factors receptorAdd BLAST787

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi32 ↔ 38PROSITE-ProRule annotation
Disulfide bondi36 ↔ 45PROSITE-ProRule annotation
Glycosylationi66N-linked (GlcNAc...)Sequence analysis1
Glycosylationi94N-linked (GlcNAc...)Sequence analysis1
Glycosylationi120N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi151 ↔ 175PROSITE-ProRule annotation
Disulfide bondi153 ↔ 193PROSITE-ProRule annotation
Glycosylationi199N-linked (GlcNAc...)Sequence analysis1
Glycosylationi204N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi217 ↔ 265PROSITE-ProRule annotation
Glycosylationi226N-linked (GlcNAc...)Sequence analysis1
Glycosylationi253N-linked (GlcNAc...)Sequence analysis1
Glycosylationi287N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi301 ↔ 344PROSITE-ProRule annotation
Glycosylationi324N-linked (GlcNAc...)Sequence analysis1
Glycosylationi337N-linked (GlcNAc...)Sequence analysis1
Glycosylationi408N-linked (GlcNAc...)Sequence analysis1
Modified residuei512Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei698Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei702Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei703Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei813Phosphotyrosine; by autocatalysisBy similarity1

Post-translational modificationi

Ligand-mediated auto-phosphorylation.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ91987.

Expressioni

Gene expression databases

BgeeiENSGALG00000012594.

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures (By similarity). Interacts with NGFR; may regulate the ligand specificity of the receptor.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei512Interaction with SHC1By similarity1
Sitei702Interaction with SH2D1ABy similarity1
Sitei813Interaction with PLCG1By similarity1

GO - Molecular functioni

Protein-protein interaction databases

STRINGi9031.ENSGALP00000020539.

Structurei

3D structure databases

ProteinModelPortaliQ91987.
SMRiQ91987.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati71 – 92LRR 1Add BLAST22
Repeati95 – 116LRR 2Add BLAST22
Domaini196 – 281Ig-like C2-type 1Add BLAST86
Domaini295 – 364Ig-like C2-type 2Add BLAST70
Domaini534 – 803Protein kinasePROSITE-ProRule annotationAdd BLAST270

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni384 – 394Provides specificity for BDNF as ligand versus NTF3 and NTF4Add BLAST11

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
Contains 2 LRR (leucine-rich) repeats.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1026. Eukaryota.
ENOG410YGKQ. LUCA.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ91987.
KOiK04360.
OMAiCSCEIMW.
OrthoDBiEOG091G01JY.
PhylomeDBiQ91987.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR000372. LRRNT.
IPR031635. NTRK_C2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020455. Tyr_kin_neurotrophic_rcpt_2.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
PF16920. TPKR_C2. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01941. NTKRECEPTOR2.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00220. S_TKc. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q91987-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-FL, cTrkB-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSWRRRPGP GLARLWGLCC LVLGCWRGAL GCPASCRCSS WRIWCSEPVP
60 70 80 90 100
GITSFPVPQR STEDDNVTEI YIANQRKLES INDNEVGFYV GLKNLTVVDS
110 120 130 140 150
GLRFVSRQAF VKNINLQYIN LSRNKLSSLS KKPFRHLGLS DLILVDNPFK
160 170 180 190 200
CSCEIMWIKK FQETKFYTEA QDIYCVDDNN KRIALMDMKV PNCDLPSANL
210 220 230 240 250
SNYNITVVEG KSITLYCDTT GGPPPNVSWV LTNLVSNHES DTSKNPASLT
260 270 280 290 300
IKNVSSMDSG LWISCVAENI VGEVQTSAEL TVFFAPNITF IESPTPDHHW
310 320 330 340 350
CIPFTVKGNP KPTLQWFYEG AILNESEYIC TKIHVINQSE YHGCLQLDNP
360 370 380 390 400
THLNNGAYTL LAKNEYGEDE KRVDAHFMSV PGDGSGPIVD PDVYEYETTP
410 420 430 440 450
NDLGDTTNNS NQITSPDVSN KENEDSITVY VVVGIAALVC TGLVIMLIIL
460 470 480 490 500
KFGRHSKFGM KGPSSVISND DDSASPLHHI SNGSNTPSSS EGGPDAVIIG
510 520 530 540 550
MTKIPVIENP QYFGITNSQL KPDTFVQHIK RHNIVLKREL GEGAFGKVFL
560 570 580 590 600
AECYNLCPEQ DKILVAVKTL KDASDNARKD FHREAELLTN LQHEHIVKFY
610 620 630 640 650
GVCVEGDPLI MVFEYMKHGD LNKFLRAHGP DAVLMAEGNR PAELTQSQML
660 670 680 690 700
HIAQQIAAGM VYLASQHFVH RDLATRNCLV GENLLVKIGD FGMSRDVYST
710 720 730 740 750
DYYRVGGHTM LPIRWMPPES IMYRKFTTES DVWSLGVVLW EIFTYGKQPW
760 770 780 790 800
YQLSNNEVIE CITQGRVLQR PRTCPKEVYD LMLGCWQREP HMRLNIKEIH
810
SLLQNLAKAS PVYLDILG
Length:818
Mass (Da):91,737
Last modified:November 1, 1996 - v1
Checksum:iD1BA39E2092B2152
GO
Isoform 2 (identifier: Q91987-2) [UniParc]FASTAAdd to basket
Also known as: Beta-FL

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Note: It is unsure whether Leu-144 or Met-188 is the initiator of isoform 2.
Show »
Length:631
Mass (Da):70,350
Checksum:iC7E35A2C54F0251E
GO
Isoform 3 (identifier: Q91987-3) [UniParc]FASTAAdd to basket
Also known as: ED

The sequence of this isoform differs from the canonical sequence as follows:
     384-394: Missing.

Show »
Length:807
Mass (Da):90,637
Checksum:iAEBC5FC2A3606887
GO
Isoform 4 (identifier: Q91987-4) [UniParc]FASTAAdd to basket
Also known as: JD

The sequence of this isoform differs from the canonical sequence as follows:
     462-465: Missing.

Show »
Length:814
Mass (Da):91,408
Checksum:i1DC6ABEC1343F811
GO
Isoform 5 (identifier: Q91987-5) [UniParc]FASTAAdd to basket
Also known as: J1

The sequence of this isoform differs from the canonical sequence as follows:
     462-462: G → VHGEVKGVGLVDQIWLSLQDCDNEG

Show »
Length:842
Mass (Da):94,373
Checksum:iA77891C66A6FC40E
GO
Isoform 6 (identifier: Q91987-6) [UniParc]FASTAAdd to basket
Also known as: Alpha-T1

The sequence of this isoform differs from the canonical sequence as follows:
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:473
Mass (Da):52,715
Checksum:i8B839EAE23A15EAB
GO
Isoform 7 (identifier: Q91987-7) [UniParc]FASTAAdd to basket
Also known as: J1+T1

The sequence of this isoform differs from the canonical sequence as follows:
     462-462: G → VHGEVKGVGLVDQIWLSLQDCDNEG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:497
Mass (Da):55,351
Checksum:i6004809297F5A125
GO
Isoform 8 (identifier: Q91987-8) [UniParc]FASTAAdd to basket
Also known as: J2+T1

The sequence of this isoform differs from the canonical sequence as follows:
     462-462: G → EQVMVTVNSDVHNNSTASDNNRLG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:496
Mass (Da):55,242
Checksum:iC2D16F0DB4F51B83
GO
Isoform 9 (identifier: Q91987-9) [UniParc]FASTAAdd to basket
Also known as: ED J2+T1, cTrkB-S

The sequence of this isoform differs from the canonical sequence as follows:
     384-394: Missing.
     462-462: G → EQVMVTVNSDVHNNSTASDNNRLG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Note: Specifically activated by BDNF but not NTF3 and NTF4.
Show »
Length:485
Mass (Da):54,142
Checksum:i3DF6F08FD2B74374
GO
Isoform 10 (identifier: Q91987-10) [UniParc]FASTAAdd to basket
Also known as: J1+J2+T1

The sequence of this isoform differs from the canonical sequence as follows:
     462-462: G → VHGEVKGVGLVDQIWLSLQDCDNEEQVMVTVNSDVHNNSTASDNNRLG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:520
Mass (Da):57,878
Checksum:i186EA70E94855A39
GO
Isoform 11 (identifier: Q91987-11) [UniParc]FASTAAdd to basket
Also known as: T3

The sequence of this isoform differs from the canonical sequence as follows:
     462-467: GPSSVI → ERGRRK
     468-818: Missing.

Show »
Length:467
Mass (Da):52,173
Checksum:iEC667B602CF40F4A
GO
Isoform 12 (identifier: Q91987-12) [UniParc]FASTAAdd to basket
Also known as: ED J1+J2+T1

The sequence of this isoform differs from the canonical sequence as follows:
     384-394: Missing.
     462-462: G → VHGEVKGVGLVDQIWLSLQDCDNEEQVMVTVNSDVHNNSTASDNNRLG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:509
Mass (Da):56,777
Checksum:i89B1E264037975D1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0029141 – 187Missing in isoform 2. CuratedAdd BLAST187
Alternative sequenceiVSP_002915384 – 394Missing in isoform 3, isoform 9 and isoform 12. CuratedAdd BLAST11
Alternative sequenceiVSP_002916462 – 467GPSSVI → ERGRRK in isoform 11. Curated6
Alternative sequenceiVSP_002923462 – 465Missing in isoform 4. Curated4
Alternative sequenceiVSP_002922462G → VHGEVKGVGLVDQIWLSLQD CDNEEQVMVTVNSDVHNNST ASDNNRLG in isoform 10 and isoform 12. 1 Publication1
Alternative sequenceiVSP_002920462G → VHGEVKGVGLVDQIWLSLQD CDNEG in isoform 5 and isoform 7. Curated1
Alternative sequenceiVSP_002921462G → EQVMVTVNSDVHNNSTASDN NRLG in isoform 8 and isoform 9. Curated1
Alternative sequenceiVSP_002918463 – 473PSSVISNDDDS → FVLFHKIPLDG in isoform 6, isoform 7, isoform 8, isoform 9, isoform 10 and isoform 12. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_002917468 – 818Missing in isoform 11. CuratedAdd BLAST351
Alternative sequenceiVSP_002919474 – 818Missing in isoform 6, isoform 7, isoform 8, isoform 9, isoform 10 and isoform 12. 1 PublicationAdd BLAST345

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X77251 mRNA. Translation: CAA54468.1.
X77252 mRNA. Translation: CAA54469.1.
X74109 mRNA. Translation: CAA52210.1.
PIRiS59938. S44099.
S59939. S44098.
RefSeqiNP_990562.1. NM_205231.1. [Q91987-1]
XP_015135735.1. XM_015280249.1. [Q91987-5]
XP_015135738.1. XM_015280252.1. [Q91987-3]
XP_015135740.1. XM_015280254.1. [Q91987-10]
XP_015135741.1. XM_015280255.1. [Q91987-7]
XP_015135742.1. XM_015280256.1. [Q91987-8]
XP_015135743.1. XM_015280257.1. [Q91987-6]
UniGeneiGga.681.

Genome annotation databases

EnsembliENSGALT00000020568; ENSGALP00000020539; ENSGALG00000012594. [Q91987-1]
GeneIDi396157.
KEGGigga:396157.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X77251 mRNA. Translation: CAA54468.1.
X77252 mRNA. Translation: CAA54469.1.
X74109 mRNA. Translation: CAA52210.1.
PIRiS59938. S44099.
S59939. S44098.
RefSeqiNP_990562.1. NM_205231.1. [Q91987-1]
XP_015135735.1. XM_015280249.1. [Q91987-5]
XP_015135738.1. XM_015280252.1. [Q91987-3]
XP_015135740.1. XM_015280254.1. [Q91987-10]
XP_015135741.1. XM_015280255.1. [Q91987-7]
XP_015135742.1. XM_015280256.1. [Q91987-8]
XP_015135743.1. XM_015280257.1. [Q91987-6]
UniGeneiGga.681.

3D structure databases

ProteinModelPortaliQ91987.
SMRiQ91987.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000020539.

Proteomic databases

PaxDbiQ91987.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000020568; ENSGALP00000020539; ENSGALG00000012594. [Q91987-1]
GeneIDi396157.
KEGGigga:396157.

Organism-specific databases

CTDi4915.

Phylogenomic databases

eggNOGiKOG1026. Eukaryota.
ENOG410YGKQ. LUCA.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ91987.
KOiK04360.
OMAiCSCEIMW.
OrthoDBiEOG091G01JY.
PhylomeDBiQ91987.

Enzyme and pathway databases

BRENDAi2.7.10.1. 1306.

Miscellaneous databases

PROiQ91987.

Gene expression databases

BgeeiENSGALG00000012594.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR000372. LRRNT.
IPR031635. NTRK_C2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020455. Tyr_kin_neurotrophic_rcpt_2.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
PF16920. TPKR_C2. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01941. NTKRECEPTOR2.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00220. S_TKc. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNTRK2_CHICK
AccessioniPrimary (citable) accession number: Q91987
Secondary accession number(s): Q91010
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: November 30, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.