Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BDNF/NT-3 growth factors receptor

Gene

NTRK2

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems through regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. Receptor for BDNF/brain-derived neurotrophic factor and NTF4/neurotrophin-4. Alternatively can also bind NTF3/neurotrophin-3 which is less efficient in activating the receptor but regulates neuron survival through NTRK2. Upon ligand-binding, undergoes homodimerization, autophosphorylation and activation. Recruits, phosphorylates and/or activates several downstream effectors that regulate distinct overlapping signaling cascades. Activates the GRB2-Ras-MAPK cascade that regulates for instance neuronal differentiation including neurite outgrowth. Controls the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. Through the downstream protein kinase C-regulated pathways controls synaptic plasticity. Thereby, plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. Also regulates the transcription of genes involved in cell survival. Hence, it is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. May also play a role in neutrophin-dependent calcium signaling in glial cells.

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Enzyme regulationi

The neuronal activity and the influx of calcium positively regulate the kinase activity and the internalization of the receptor which are both important for active signaling. Regulated by NGFR that may control the internalization of the receptor. NGFR may also stimulate the activation by BDNF compared to NTF3 and NTF4. The formation of active receptors dimers able to fully transduce the ligand-mediated signal, may be negatively regulated by the formation of inactive heterodimers with the non-catalytic isoforms (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei568 – 5681ATPPROSITE-ProRule annotation
Active sitei672 – 6721Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi540 – 5489ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Differentiation, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.10.1. 1306.

Names & Taxonomyi

Protein namesi
Recommended name:
BDNF/NT-3 growth factors receptor (EC:2.7.10.1)
Alternative name(s):
Neurotrophic tyrosine kinase receptor type 2
TrkB tyrosine kinase
Short name:
Trk-B
Gene namesi
Name:NTRK2
Synonyms:TRKB
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Chromosome Z

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini32 – 426395ExtracellularSequence analysisAdd
BLAST
Transmembranei427 – 45024HelicalSequence analysisAdd
BLAST
Topological domaini451 – 818368CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131By similarityAdd
BLAST
Chaini32 – 818787BDNF/NT-3 growth factors receptorPRO_0000016730Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi32 ↔ 38PROSITE-ProRule annotation
Disulfide bondi36 ↔ 45PROSITE-ProRule annotation
Glycosylationi66 – 661N-linked (GlcNAc...)Sequence analysis
Glycosylationi94 – 941N-linked (GlcNAc...)Sequence analysis
Glycosylationi120 – 1201N-linked (GlcNAc...)Sequence analysis
Disulfide bondi151 ↔ 175PROSITE-ProRule annotation
Disulfide bondi153 ↔ 193PROSITE-ProRule annotation
Glycosylationi199 – 1991N-linked (GlcNAc...)Sequence analysis
Glycosylationi204 – 2041N-linked (GlcNAc...)Sequence analysis
Disulfide bondi217 ↔ 265PROSITE-ProRule annotation
Glycosylationi226 – 2261N-linked (GlcNAc...)Sequence analysis
Glycosylationi253 – 2531N-linked (GlcNAc...)Sequence analysis
Glycosylationi287 – 2871N-linked (GlcNAc...)Sequence analysis
Disulfide bondi301 ↔ 344PROSITE-ProRule annotation
Glycosylationi324 – 3241N-linked (GlcNAc...)Sequence analysis
Glycosylationi337 – 3371N-linked (GlcNAc...)Sequence analysis
Glycosylationi408 – 4081N-linked (GlcNAc...)Sequence analysis
Modified residuei512 – 5121Phosphotyrosine; by autocatalysisBy similarity
Modified residuei698 – 6981Phosphotyrosine; by autocatalysisBy similarity
Modified residuei702 – 7021Phosphotyrosine; by autocatalysisBy similarity
Modified residuei703 – 7031Phosphotyrosine; by autocatalysisBy similarity
Modified residuei813 – 8131Phosphotyrosine; by autocatalysisBy similarity

Post-translational modificationi

Ligand-mediated auto-phosphorylation.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ91987.

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures (By similarity). Interacts with NGFR; may regulate the ligand specificity of the receptor.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei512 – 5121Interaction with SHC1By similarity
Sitei702 – 7021Interaction with SH2D1ABy similarity
Sitei813 – 8131Interaction with PLCG1By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi9031.ENSGALP00000020539.

Structurei

3D structure databases

ProteinModelPortaliQ91987.
SMRiQ91987. Positions 282-382.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati71 – 9222LRR 1Add
BLAST
Repeati95 – 11622LRR 2Add
BLAST
Domaini196 – 28186Ig-like C2-type 1Add
BLAST
Domaini295 – 36470Ig-like C2-type 2Add
BLAST
Domaini534 – 803270Protein kinasePROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni384 – 39411Provides specificity for BDNF as ligand versus NTF3 and NTF4Add
BLAST

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
Contains 2 LRR (leucine-rich) repeats.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1026. Eukaryota.
ENOG410YGKQ. LUCA.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ91987.
KOiK04360.
OMAiCSCEIMW.
PhylomeDBiQ91987.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR000372. LRRNT.
IPR031635. NTRK_C2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020455. Tyr_kin_neurotrophic_rcpt_2.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
PF16920. TPKR_C2. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01941. NTKRECEPTOR2.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00220. S_TKc. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q91987-1) [UniParc]FASTAAdd to basket

Also known as: Alpha-FL, cTrkB-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSWRRRPGP GLARLWGLCC LVLGCWRGAL GCPASCRCSS WRIWCSEPVP
60 70 80 90 100
GITSFPVPQR STEDDNVTEI YIANQRKLES INDNEVGFYV GLKNLTVVDS
110 120 130 140 150
GLRFVSRQAF VKNINLQYIN LSRNKLSSLS KKPFRHLGLS DLILVDNPFK
160 170 180 190 200
CSCEIMWIKK FQETKFYTEA QDIYCVDDNN KRIALMDMKV PNCDLPSANL
210 220 230 240 250
SNYNITVVEG KSITLYCDTT GGPPPNVSWV LTNLVSNHES DTSKNPASLT
260 270 280 290 300
IKNVSSMDSG LWISCVAENI VGEVQTSAEL TVFFAPNITF IESPTPDHHW
310 320 330 340 350
CIPFTVKGNP KPTLQWFYEG AILNESEYIC TKIHVINQSE YHGCLQLDNP
360 370 380 390 400
THLNNGAYTL LAKNEYGEDE KRVDAHFMSV PGDGSGPIVD PDVYEYETTP
410 420 430 440 450
NDLGDTTNNS NQITSPDVSN KENEDSITVY VVVGIAALVC TGLVIMLIIL
460 470 480 490 500
KFGRHSKFGM KGPSSVISND DDSASPLHHI SNGSNTPSSS EGGPDAVIIG
510 520 530 540 550
MTKIPVIENP QYFGITNSQL KPDTFVQHIK RHNIVLKREL GEGAFGKVFL
560 570 580 590 600
AECYNLCPEQ DKILVAVKTL KDASDNARKD FHREAELLTN LQHEHIVKFY
610 620 630 640 650
GVCVEGDPLI MVFEYMKHGD LNKFLRAHGP DAVLMAEGNR PAELTQSQML
660 670 680 690 700
HIAQQIAAGM VYLASQHFVH RDLATRNCLV GENLLVKIGD FGMSRDVYST
710 720 730 740 750
DYYRVGGHTM LPIRWMPPES IMYRKFTTES DVWSLGVVLW EIFTYGKQPW
760 770 780 790 800
YQLSNNEVIE CITQGRVLQR PRTCPKEVYD LMLGCWQREP HMRLNIKEIH
810
SLLQNLAKAS PVYLDILG
Length:818
Mass (Da):91,737
Last modified:November 1, 1996 - v1
Checksum:iD1BA39E2092B2152
GO
Isoform 2 (identifier: Q91987-2) [UniParc]FASTAAdd to basket

Also known as: Beta-FL

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Note: It is unsure whether Leu-144 or Met-188 is the initiator of isoform 2.
Show »
Length:631
Mass (Da):70,350
Checksum:iC7E35A2C54F0251E
GO
Isoform 3 (identifier: Q91987-3) [UniParc]FASTAAdd to basket

Also known as: ED

The sequence of this isoform differs from the canonical sequence as follows:
     384-394: Missing.

Show »
Length:807
Mass (Da):90,637
Checksum:iAEBC5FC2A3606887
GO
Isoform 4 (identifier: Q91987-4) [UniParc]FASTAAdd to basket

Also known as: JD

The sequence of this isoform differs from the canonical sequence as follows:
     462-465: Missing.

Show »
Length:814
Mass (Da):91,408
Checksum:i1DC6ABEC1343F811
GO
Isoform 5 (identifier: Q91987-5) [UniParc]FASTAAdd to basket

Also known as: J1

The sequence of this isoform differs from the canonical sequence as follows:
     462-462: G → VHGEVKGVGLVDQIWLSLQDCDNEG

Show »
Length:842
Mass (Da):94,373
Checksum:iA77891C66A6FC40E
GO
Isoform 6 (identifier: Q91987-6) [UniParc]FASTAAdd to basket

Also known as: Alpha-T1

The sequence of this isoform differs from the canonical sequence as follows:
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:473
Mass (Da):52,715
Checksum:i8B839EAE23A15EAB
GO
Isoform 7 (identifier: Q91987-7) [UniParc]FASTAAdd to basket

Also known as: J1+T1

The sequence of this isoform differs from the canonical sequence as follows:
     462-462: G → VHGEVKGVGLVDQIWLSLQDCDNEG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:497
Mass (Da):55,351
Checksum:i6004809297F5A125
GO
Isoform 8 (identifier: Q91987-8) [UniParc]FASTAAdd to basket

Also known as: J2+T1

The sequence of this isoform differs from the canonical sequence as follows:
     462-462: G → EQVMVTVNSDVHNNSTASDNNRLG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:496
Mass (Da):55,242
Checksum:iC2D16F0DB4F51B83
GO
Isoform 9 (identifier: Q91987-9) [UniParc]FASTAAdd to basket

Also known as: ED J2+T1, cTrkB-S

The sequence of this isoform differs from the canonical sequence as follows:
     384-394: Missing.
     462-462: G → EQVMVTVNSDVHNNSTASDNNRLG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Note: Specifically activated by BDNF but not NTF3 and NTF4.
Show »
Length:485
Mass (Da):54,142
Checksum:i3DF6F08FD2B74374
GO
Isoform 10 (identifier: Q91987-10) [UniParc]FASTAAdd to basket

Also known as: J1+J2+T1

The sequence of this isoform differs from the canonical sequence as follows:
     462-462: G → VHGEVKGVGLVDQIWLSLQDCDNEEQVMVTVNSDVHNNSTASDNNRLG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:520
Mass (Da):57,878
Checksum:i186EA70E94855A39
GO
Isoform 11 (identifier: Q91987-11) [UniParc]FASTAAdd to basket

Also known as: T3

The sequence of this isoform differs from the canonical sequence as follows:
     462-467: GPSSVI → ERGRRK
     468-818: Missing.

Show »
Length:467
Mass (Da):52,173
Checksum:iEC667B602CF40F4A
GO
Isoform 12 (identifier: Q91987-12) [UniParc]FASTAAdd to basket

Also known as: ED J1+J2+T1

The sequence of this isoform differs from the canonical sequence as follows:
     384-394: Missing.
     462-462: G → VHGEVKGVGLVDQIWLSLQDCDNEEQVMVTVNSDVHNNSTASDNNRLG
     463-473: PSSVISNDDDS → FVLFHKIPLDG
     474-818: Missing.

Show »
Length:509
Mass (Da):56,777
Checksum:i89B1E264037975D1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 187187Missing in isoform 2. CuratedVSP_002914Add
BLAST
Alternative sequencei384 – 39411Missing in isoform 3, isoform 9 and isoform 12. CuratedVSP_002915Add
BLAST
Alternative sequencei462 – 4676GPSSVI → ERGRRK in isoform 11. CuratedVSP_002916
Alternative sequencei462 – 4654Missing in isoform 4. CuratedVSP_002923
Alternative sequencei462 – 4621G → VHGEVKGVGLVDQIWLSLQD CDNEEQVMVTVNSDVHNNST ASDNNRLG in isoform 10 and isoform 12. 1 PublicationVSP_002922
Alternative sequencei462 – 4621G → VHGEVKGVGLVDQIWLSLQD CDNEG in isoform 5 and isoform 7. CuratedVSP_002920
Alternative sequencei462 – 4621G → EQVMVTVNSDVHNNSTASDN NRLG in isoform 8 and isoform 9. CuratedVSP_002921
Alternative sequencei463 – 47311PSSVISNDDDS → FVLFHKIPLDG in isoform 6, isoform 7, isoform 8, isoform 9, isoform 10 and isoform 12. 1 PublicationVSP_002918Add
BLAST
Alternative sequencei468 – 818351Missing in isoform 11. CuratedVSP_002917Add
BLAST
Alternative sequencei474 – 818345Missing in isoform 6, isoform 7, isoform 8, isoform 9, isoform 10 and isoform 12. 1 PublicationVSP_002919Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X77251 mRNA. Translation: CAA54468.1.
X77252 mRNA. Translation: CAA54469.1.
X74109 mRNA. Translation: CAA52210.1.
PIRiS59938. S44099.
S59939. S44098.
RefSeqiNP_990562.1. NM_205231.1. [Q91987-1]
XP_015135735.1. XM_015280249.1. [Q91987-5]
XP_015135738.1. XM_015280252.1. [Q91987-3]
XP_015135740.1. XM_015280254.1. [Q91987-10]
XP_015135741.1. XM_015280255.1. [Q91987-7]
XP_015135742.1. XM_015280256.1. [Q91987-8]
XP_015135743.1. XM_015280257.1. [Q91987-6]
UniGeneiGga.681.

Genome annotation databases

EnsembliENSGALT00000020568; ENSGALP00000020539; ENSGALG00000012594. [Q91987-5]
GeneIDi396157.
KEGGigga:396157.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X77251 mRNA. Translation: CAA54468.1.
X77252 mRNA. Translation: CAA54469.1.
X74109 mRNA. Translation: CAA52210.1.
PIRiS59938. S44099.
S59939. S44098.
RefSeqiNP_990562.1. NM_205231.1. [Q91987-1]
XP_015135735.1. XM_015280249.1. [Q91987-5]
XP_015135738.1. XM_015280252.1. [Q91987-3]
XP_015135740.1. XM_015280254.1. [Q91987-10]
XP_015135741.1. XM_015280255.1. [Q91987-7]
XP_015135742.1. XM_015280256.1. [Q91987-8]
XP_015135743.1. XM_015280257.1. [Q91987-6]
UniGeneiGga.681.

3D structure databases

ProteinModelPortaliQ91987.
SMRiQ91987. Positions 282-382.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000020539.

Proteomic databases

PaxDbiQ91987.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000020568; ENSGALP00000020539; ENSGALG00000012594. [Q91987-5]
GeneIDi396157.
KEGGigga:396157.

Organism-specific databases

CTDi4915.

Phylogenomic databases

eggNOGiKOG1026. Eukaryota.
ENOG410YGKQ. LUCA.
GeneTreeiENSGT00760000118818.
HOGENOMiHOG000264255.
HOVERGENiHBG056735.
InParanoidiQ91987.
KOiK04360.
OMAiCSCEIMW.
PhylomeDBiQ91987.

Enzyme and pathway databases

BRENDAi2.7.10.1. 1306.

Miscellaneous databases

PROiQ91987.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR000372. LRRNT.
IPR031635. NTRK_C2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020455. Tyr_kin_neurotrophic_rcpt_2.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
PF16920. TPKR_C2. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01941. NTKRECEPTOR2.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00220. S_TKc. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Cloning and sequence analysis of a cDNA encoding a novel truncated form of the chicken TrkB receptor."
    Vinh N., Erdmann K., Heumann R.
    Gene 149:383-384(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 10).
    Tissue: Brain.
  2. "Expression and binding characteristics of the BDNF receptor chick trkB."
    Dechant G., Biffo S., Okazawa H., Kolbeck R., Pottgiesser J., Barde Y.-A.
    Development 119:545-558(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Expression of TrkB receptor isoforms in the developing avian visual system."
    Garner A.S., Menegay H.J., Boeshore K.L., Xie X.Y., Voci J.M., Johnson J.E., Large T.H.
    J. Neurosci. 16:1740-1752(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE (ISOFORMS 2; 3; 4; 5; 6; 7; 8; 9; 10; 11 AND 12).
  4. "A splice variant of the neurotrophin receptor trkB with increased specificity for brain-derived neurotrophic factor."
    Strohmaier C., Carter B.D., Urfer R., Barde Y.A., Dechant G.
    EMBO J. 15:3332-3337(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORMS 1 AND 9), LIGAND-BINDING.

Entry informationi

Entry nameiNTRK2_CHICK
AccessioniPrimary (citable) accession number: Q91987
Secondary accession number(s): Q91010
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: June 8, 2016
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.