Reviewed,
UniProtKB/Swiss-Prot Q91309 (F26_RANCA)
Last modified
June 16, 2009.
Version 63.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 6PF-2-K/Fru-2,6-P2ASE liver/muscle isozymes Including the following 2 domains: 1- Recommended name: 6-phosphofructo-2-kinase EC=2.7.1.105 2- Recommended name: Fructose-2,6-bisphosphatase EC=3.1.3.46 |
| Organism | Rana catesbeiana (Bull frog) |
| Taxonomic identifier | 8400 [NCBI] |
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Amphibia › Batrachia › Anura › Neobatrachia › Ranoidea › Ranidae › Rana › Aquarana |
Protein attributes
| Sequence length | 470 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Synthesis and degradation of fructose 2,6-bisphosphate. |
| Catalytic activity | Beta-D-fructose 2,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate. ATP + D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate. |
| Enzyme regulation | Phosphorylation results in inhibition of the kinase activity By similarity. |
| Subunit structure | Homodimer By similarity. |
| Sequence similarities | In the C-terminal section; belongs to the phosphoglycerate mutase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Hydrolase Kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Multifunctional enzyme |
| Gene Ontology (GO) | |
| Biological process | fructose 2,6-bisphosphate metabolic process Inferred from electronic annotation. Source: InterPro |
| Molecular function | 6-phosphofructo-2-kinase activity Inferred from electronic annotation. Source: EC ATP bindingInferred from electronic annotation. Source: UniProtKB-KW fructose-2,6-bisphosphate 2-phosphatase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Liver (identifier: Q91309-1) Also known as: L-type; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Muscle (identifier: Q91309-2) Also known as: M-type; The sequence of this isoform differs from the canonical sequence as follows: 1-31: MADRLRELTQTRLQKIWIPHQCDRLQQRRGS → MEGNYKLLEDKASRIPA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 470 | 470 | 6PF-2-K/Fru-2,6-P2ASE liver/muscle isozymes | PRO_0000179973 | |||||
Regions | |||||||||
| Nucleotide binding | 47 – 54 | 8 | ATP Potential | ||||||
| Region | 1 – 249 | 249 | 6-phosphofructo-2-kinase | ||||||
| Region | 250 – 470 | 221 | Fructose-2,6-bisphosphatase | ||||||
Sites | |||||||||
| Active site | 130 | 1 | Potential | ||||||
| Active site | 160 | 1 | Potential | ||||||
| Active site | 258 | 1 | Tele-phosphohistidine intermediate | ||||||
| Active site | 327 | 1 | Potential | ||||||
| Active site | 392 | 1 | Proton donor By similarity | ||||||
| Binding site | 104 | 1 | Fructose-6-phosphate By similarity | ||||||
| Binding site | 195 | 1 | Fructose-6-phosphate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 31 | 1 | Phosphoserine; by PKA By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 31 | 31 | MADRL…QRRGS → MEGNYKLLEDKASRIPA in isoform Muscle. | VSP_004685 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Cloning of cDNAs for fructose 6-phosphate 2-kinase/fructose 2,6-bisphosphatase from frog skeletal muscle and liver, and their expression in skeletal muscle." Sakai A., Watanabe F., Furuya E. Biochem. Biophys. Res. Commun. 198:1099-1106(1994) [PubMed: 7509597] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LIVER AND MUSCLE). Tissue: Liver and Muscle. |
Cross-references
Sequence databases | |
|---|---|
| D25223 mRNA. Translation: BAA04952.1. D25222 mRNA. Translation: BAA04951.1. | |
| PIR | JC2064. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1C80 based on UniProtKB P07953. |
| SMR | Q91309. Positions 40-469. |
| ModBase | Search... |
Phylogenomic databases | |
| HOVERGEN | Q91309. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.105. 829. 3.1.3.46. 829. |
Family and domain databases | |
| InterPro | IPR003094. 6Pfruct_kin. IPR013079. 6Phosfructo_kin. IPR016260. Bifunct_6PFK/fruc_bisP_Ptase. IPR001345. PG/BPGM_mutase. IPR013078. PG_mutase. [Graphical view] |
| PANTHER | PTHR10606. 6Pfruct_kin. 1 hit. |
| Pfam | PF01591. 6PF2K. 1 hit. PF00300. PGAM. 1 hit. [Graphical view] |
| PIRSF | PIRSF000709. 6PFK_2-Ptase. 1 hit. |
| PRINTS | PR00991. 6PFRUCTKNASE. |
| PROSITE | PS00175. PG_MUTASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | F26_RANCA | ||||||||
| Accession | Primary (citable) accession number: Q91309 Secondary accession number(s): Q91310 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||

Clusters with


