Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q91044 (NTRK3_CHICK) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
NT-3 growth factor receptor

EC=2.7.10.1
Alternative name(s):
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Short name=Trk-C
Gene names
Name:NTRK3
Synonyms:TRKC
OrganismGallus gallus (Chicken) [Reference proteome]
Taxonomic identifier9031 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus

Protein attributes

Sequence length827 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the trk receptors are SHC1, PI-3 kinase and PLCG1. The KT and KD isoforms fail to stimulate transformation, process outgrowth or survival. Isoform KI25 exhibits tyrosine phosphorylation in the absence of ligand and is unable to mediate survival of neuronal cells.

Catalytic activity

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Subunit structure

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures.

Subcellular location

Membrane; Single-pass type I membrane protein.

Developmental stage

Expression occurs in the embryonal day 2 (E2) embryo with increasing levels later in development. In the E9 embryo highest levels are found in brain and spinal cord with intermediate levels in eye, heart, gut and muscle. Low levels are found in kidney, liver, skin and yolk sac.

Post-translational modification

Ligand-mediated auto-phosphorylation By similarity.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.

Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Contains 2 LRR (leucine-rich) repeats.

Contains 1 LRRCT domain.

Contains 1 protein kinase domain.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform Alpha-FL (identifier: Q91044-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Alpha-KT (identifier: Q91044-2)

The sequence of this isoform differs from the canonical sequence as follows:
     633-664: AHGPDAMILVDGQPRQAKGELGLSQMLHIASQ → LEDTPCCLSAGCLRRASCTGSSQRRVTSGASG
     665-827: Missing.
Isoform Alpha-KD (identifier: Q91044-3)

The sequence of this isoform differs from the canonical sequence as follows:
     581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF
     620-827: Missing.
Isoform Beta-KD (identifier: Q91044-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF
     620-827: Missing.
Isoform TRKC-3 (identifier: Q91044-5)

The sequence of this isoform differs from the canonical sequence as follows:
     581-599: LAARKDFQREAELLTNLQH → CFREIMLNPISLPGHCQTS
     600-827: Missing.
Note: The kinase domain is of 19 aa instead of 39aa in the isoform alpha-KD due to a frameshift.
Isoform KI25 (identifier: Q91044-6)

The sequence of this isoform differs from the canonical sequence as follows:
     713-713: R → REGPRPKGQLSTAWQRHRLAPPAAAT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3131 By similarity
Chain32 – 827796NT-3 growth factor receptor
PRO_0000016736

Regions

Topological domain32 – 430399Extracellular Potential
Transmembrane431 – 45525Helical; Potential
Topological domain456 – 827372Cytoplasmic Potential
Repeat104 – 12522LRR 1
Repeat128 – 14922LRR 2
Domain160 – 20950LRRCT
Domain210 – 30091Ig-like C2-type 1
Domain319 – 38264Ig-like C2-type 2
Domain540 – 812273Protein kinase
Nucleotide binding546 – 5549ATP By similarity

Sites

Active site6811Proton acceptor By similarity
Binding site5741ATP By similarity
Site5181Interaction with SHC1 By similarity
Site8221Interaction with PLC-gamma-1 By similarity

Amino acid modifications

Modified residue5181Phosphotyrosine; by autocatalysis By similarity
Modified residue7071Phosphotyrosine; by autocatalysis By similarity
Modified residue7111Phosphotyrosine; by autocatalysis By similarity
Modified residue7121Phosphotyrosine; by autocatalysis By similarity
Modified residue8221Phosphotyrosine; by autocatalysis By similarity
Glycosylation681N-linked (GlcNAc...) Potential
Glycosylation721N-linked (GlcNAc...) Potential
Glycosylation791N-linked (GlcNAc...) Potential
Glycosylation1631N-linked (GlcNAc...) Potential
Glycosylation2031N-linked (GlcNAc...) Potential
Glycosylation2181N-linked (GlcNAc...) Potential
Glycosylation2321N-linked (GlcNAc...) Potential
Glycosylation2591N-linked (GlcNAc...) Potential
Glycosylation2671N-linked (GlcNAc...) Potential
Glycosylation2721N-linked (GlcNAc...) Potential
Glycosylation2941N-linked (GlcNAc...) Potential
Glycosylation3751N-linked (GlcNAc...) Potential
Glycosylation3881N-linked (GlcNAc...) Potential
Disulfide bond320 ↔ 362 By similarity

Natural variations

Alternative sequence1 – 9898Missing in isoform Beta-KD.
VSP_002938
Alternative sequence581 – 61939LAARK…LIMVF → CFREIMLNPISLPGHSKPLN QGIYVEDVSVYFSKGRHGF in isoform Alpha-KD and isoform Beta-KD.
VSP_002939
Alternative sequence581 – 59919LAARK…TNLQH → CFREIMLNPISLPGHCQTS in isoform TRKC-3.
VSP_002941
Alternative sequence600 – 827228Missing in isoform TRKC-3.
VSP_002942
Alternative sequence620 – 827208Missing in isoform Alpha-KD and isoform Beta-KD.
VSP_002940
Alternative sequence633 – 66432AHGPD…HIASQ → LEDTPCCLSAGCLRRASCTG SSQRRVTSGASG in isoform Alpha-KT.
VSP_002943
Alternative sequence665 – 827163Missing in isoform Alpha-KT.
VSP_002944
Alternative sequence7131R → REGPRPKGQLSTAWQRHRLA PPAAAT in isoform KI25.
VSP_002945

Experimental info

Sequence conflict1 – 3939MDVSL…NCLCS → MHFICWRIFASDRLKVLF Ref.2
Sequence conflict1241A → G in CAA42202. Ref.2
Sequence conflict3781I → F in CAA82907. Ref.3
Sequence conflict481 – 49616SPLHH…TPSSL → ATHTSTTDTRFVT in CAA42202. Ref.2
Sequence conflict7951W → C in CAA42202. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform Alpha-FL [UniParc].

Last modified July 15, 1999. Version 2.
Checksum: AB97373113DCB28A

FASTA82793,181
        10         20         30         40         50         60 
MDVSLCPTKC TFWRVFLLWS IWGDYLLSVL ACPANCLCSK TDINCKKPDD GNLFPLLEGQ 

        70         80         90        100        110        120 
DSGSSNGNTS INITDISRNI TSIHIENWKN LQTLNAVDME LYTGLQRLTI RNSGLRNIQP 

       130        140        150        160        170        180 
RAFAKNPHLR YIDLSGNRLT TLSWQLFQTL RLFDLRLERN PFNCSCDIRW IQLWQEKGEA 

       190        200        210        220        230        240 
NLQSQQLHCM NLDTAVILLR NMNITQCDLP EISVSHVNLT VREGENAVIT CNGSGSPLPD 

       250        260        270        280        290        300 
VDWTVADLHS INTHQTNLNW TNVHAINLTL VNVTSEDNGF LLTCIAENVV GMSNASVLLT 

       310        320        330        340        350        360 
VYYPPRILTL EEPVLHLEHC IAFAVHGNPA PTLHWLHNGQ VLRETEIIHM EFYQQGEVSE 

       370        380        390        400        410        420 
GCLLFNKPTH YNNGNYTIVA TNQLGSANQT IKGHFLEKPF PESTDNFVSI GDYEVSPTPP 

       430        440        450        460        470        480 
ITVTHKPEED TFGVSIAVGL AAFACVLLVV LFIMINKYGR RSKFGMKGPV AVISGEEDSA 

       490        500        510        520        530        540 
SPLHHINHGI TTPSSLDAGP DTVVIGMTRI PVIENPQYFR QGHNCHKPDT YVQHIKRRDI 

       550        560        570        580        590        600 
VLKRELGEGA FGKVFLAECY NLSPTNDKML VAVKALKDPT LAARKDFQRE AELLTNLQHE 

       610        620        630        640        650        660 
HIVKFYGVCG DGDPLIMVFE YMKHGDLNKF LRAHGPDAMI LVDGQPRQAK GELGLSQMLH 

       670        680        690        700        710        720 
IASQIASGMV YLASQHFVHR DLATRNCLVG ANLLVKIGDF GMSRDVYSTD YYRVGGHTML 

       730        740        750        760        770        780 
PIRWMPPESI MYRKFTTESD VWSFGVILWE IFTYGKQPWF QLSNTEVIEC ITQGRVLERP 

       790        800        810        820 
RVCPKEVYDI MLGCWQREPQ QRLNIKEIYK ILHALGKATP IYLDILG 

« Hide

Isoform Alpha-KT [UniParc].

Checksum: 11028413AB7DC850
Show »

FASTA66474,109
Isoform Alpha-KD [UniParc].

Checksum: 13E6054D108EC9E8
Show »

FASTA61969,225
Isoform Beta-KD [UniParc].

Checksum: E62888AE1B708EA1
Show »

FASTA52158,334
Isoform TRKC-3 [UniParc].

Checksum: ED8F7FED76FA0EA8
Show »

FASTA59966,934
Isoform KI25 [UniParc].

Checksum: 30DEB2057E27A274
Show »

FASTA85295,860

References

[1]"Isoforms of the avian TrkC receptor: a novel kinase insertion dissociates transformation and process outgrowth from survival."
Garner A.S., Large T.H.
Neuron 13:457-472(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-FL; ALPHA-KT; ALPHA-KD; BETA-KD AND KI25).
Tissue: Embryonic brain.
[2]"Molecular cloning and expression of a novel truncated form of chicken trkC."
Okazawa H., Kamei M., Kanazawa I.
FEBS Lett. 329:171-177(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-FL AND TRKC-3).
[3]"Molecular cloning and cellular localization of trkC in the chicken embryo."
Williams R., Backstrom A., Ebendal T., Hallboeoek F.
Brain Res. Dev. Brain Res. 75:235-252(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 378-513.
Tissue: Embryo.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
S74248 mRNA. Translation: AAB31699.1.
X59669 mRNA. Translation: CAA42202.1.
Z30091 mRNA. Translation: CAA82907.1.
PIRI51222.
I51259.
S35695.
RefSeqNP_990500.1. NM_205169.1. [Q91044-6]
UniGeneGga.509.

3D structure databases

ProteinModelPortalQ91044.
SMRQ91044. Positions 300-401.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-127882.
STRING9031.ENSGALP00000010970.

Protein family/group databases

MEROPSI43.001.

Proteomic databases

PaxDbQ91044.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID396081.
KEGGgga:396081.

Organism-specific databases

CTD4916.

Phylogenomic databases

eggNOGCOG0515.
HOVERGENHBG056735.
KOK05101.
PhylomeDBQ91044.

Enzyme and pathway databases

BRENDA2.7.10.1. 1306.

Family and domain databases

Gene3D2.60.40.10. 2 hits.
InterProIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMSSF56112. SSF56112. 1 hit.
PROSITEPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio20816139.
PROQ91044.

Entry information

Entry nameNTRK3_CHICK
AccessionPrimary (citable) accession number: Q91044
Secondary accession number(s): Q91011, Q92022
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 15, 1999
Last modified: May 14, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families