Q91044 (NTRK3_CHICK) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NT-3 growth factor receptor EC=2.7.10.1 Alternative name(s): Neurotrophic tyrosine kinase receptor type 3 TrkC tyrosine kinase Short name=Trk-C | ||||
| Gene names |
| ||||
| Organism | Gallus gallus (Chicken) [Reference proteome] | ||||
| Taxonomic identifier | 9031 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Archosauria › Dinosauria › Saurischia › Theropoda › Coelurosauria › Aves › Neognathae › Galliformes › Phasianidae › Phasianinae › Gallus![]() |
Protein attributes
| Sequence length | 827 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the trk receptors are SHC1, PI-3 kinase and PLCG1. The KT and KD isoforms fail to stimulate transformation, process outgrowth or survival. Isoform KI25 exhibits tyrosine phosphorylation in the absence of ligand and is unable to mediate survival of neuronal cells. |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Subunit structure | Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. |
| Subcellular location | |
| Developmental stage | Expression occurs in the embryonal day 2 (E2) embryo with increasing levels later in development. In the E9 embryo highest levels are found in brain and spinal cord with intermediate levels in eye, heart, gut and muscle. Low levels are found in kidney, liver, skin and yolk sac. |
| Post-translational modification | Ligand-mediated auto-phosphorylation By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily. Contains 2 Ig-like C2-type (immunoglobulin-like) domains. Contains 2 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform Alpha-FL (identifier: Q91044-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Alpha-KT (identifier: Q91044-2) The sequence of this isoform differs from the canonical sequence as follows: 633-664: AHGPDAMILVDGQPRQAKGELGLSQMLHIASQ → LEDTPCCLSAGCLRRASCTGSSQRRVTSGASG 665-827: Missing. | ||||||
| Isoform Alpha-KD (identifier: Q91044-3) The sequence of this isoform differs from the canonical sequence as follows: 581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF 620-827: Missing. | ||||||
| Isoform Beta-KD (identifier: Q91044-4) The sequence of this isoform differs from the canonical sequence as follows: 1-98: Missing. 581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF 620-827: Missing. | ||||||
| Isoform TRKC-3 (identifier: Q91044-5) The sequence of this isoform differs from the canonical sequence as follows: 581-599: LAARKDFQREAELLTNLQH → CFREIMLNPISLPGHCQTS 600-827: Missing. | ||||||
| Note: The kinase domain is of 19 aa instead of 39aa in the isoform alpha-KD due to a frameshift. | ||||||
| Isoform KI25 (identifier: Q91044-6) The sequence of this isoform differs from the canonical sequence as follows: 713-713: R → REGPRPKGQLSTAWQRHRLAPPAAAT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | By similarity | ||||||||
| Chain | 32 – 827 | 796 | NT-3 growth factor receptor | PRO_0000016736 | |||||||
Regions | |||||||||||
| Topological domain | 32 – 430 | 399 | Extracellular Potential | ||||||||
| Transmembrane | 431 – 455 | 25 | Helical; Potential | ||||||||
| Topological domain | 456 – 827 | 372 | Cytoplasmic Potential | ||||||||
| Repeat | 104 – 125 | 22 | LRR 1 | ||||||||
| Repeat | 128 – 149 | 22 | LRR 2 | ||||||||
| Domain | 160 – 209 | 50 | LRRCT | ||||||||
| Domain | 210 – 300 | 91 | Ig-like C2-type 1 | ||||||||
| Domain | 319 – 382 | 64 | Ig-like C2-type 2 | ||||||||
| Domain | 540 – 812 | 273 | Protein kinase | ||||||||
| Nucleotide binding | 546 – 554 | 9 | ATP By similarity | ||||||||
Sites | |||||||||||
| Active site | 681 | 1 | Proton acceptor By similarity | ||||||||
| Binding site | 574 | 1 | ATP By similarity | ||||||||
| Site | 518 | 1 | Interaction with SHC1 By similarity | ||||||||
| Site | 822 | 1 | Interaction with PLC-gamma-1 By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 518 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 707 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 711 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 712 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Modified residue | 822 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||
| Glycosylation | 68 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 72 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 79 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 163 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 203 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 218 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 259 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 267 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 272 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 294 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 375 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 388 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 320 ↔ 362 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 98 | 98 | Missing in isoform Beta-KD. | VSP_002938 | |||||||
| Alternative sequence | 581 – 619 | 39 | LAARK…LIMVF → CFREIMLNPISLPGHSKPLN QGIYVEDVSVYFSKGRHGF in isoform Alpha-KD and isoform Beta-KD. | VSP_002939 | |||||||
| Alternative sequence | 581 – 599 | 19 | LAARK…TNLQH → CFREIMLNPISLPGHCQTS in isoform TRKC-3. | VSP_002941 | |||||||
| Alternative sequence | 600 – 827 | 228 | Missing in isoform TRKC-3. | VSP_002942 | |||||||
| Alternative sequence | 620 – 827 | 208 | Missing in isoform Alpha-KD and isoform Beta-KD. | VSP_002940 | |||||||
| Alternative sequence | 633 – 664 | 32 | AHGPD…HIASQ → LEDTPCCLSAGCLRRASCTG SSQRRVTSGASG in isoform Alpha-KT. | VSP_002943 | |||||||
| Alternative sequence | 665 – 827 | 163 | Missing in isoform Alpha-KT. | VSP_002944 | |||||||
| Alternative sequence | 713 | 1 | R → REGPRPKGQLSTAWQRHRLA PPAAAT in isoform KI25. | VSP_002945 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 1 – 39 | 39 | MDVSL…NCLCS → MHFICWRIFASDRLKVLF Ref.2 | ||||||||
| Sequence conflict | 124 | 1 | A → G in CAA42202. Ref.2 | ||||||||
| Sequence conflict | 378 | 1 | I → F in CAA82907. Ref.3 | ||||||||
| Sequence conflict | 481 – 496 | 16 | SPLHH…TPSSL → ATHTSTTDTRFVT in CAA42202. Ref.2 | ||||||||
| Sequence conflict | 795 | 1 | W → C in CAA42202. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Isoforms of the avian TrkC receptor: a novel kinase insertion dissociates transformation and process outgrowth from survival." Garner A.S., Large T.H. Neuron 13:457-472(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-FL; ALPHA-KT; ALPHA-KD; BETA-KD AND KI25). Tissue: Embryonic brain. |
| [2] | "Molecular cloning and expression of a novel truncated form of chicken trkC." Okazawa H., Kamei M., Kanazawa I. FEBS Lett. 329:171-177(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-FL AND TRKC-3). |
| [3] | "Molecular cloning and cellular localization of trkC in the chicken embryo." Williams R., Backstrom A., Ebendal T., Hallboeoek F. Brain Res. Dev. Brain Res. 75:235-252(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 378-513. Tissue: Embryo. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | S74248 mRNA. Translation: AAB31699.1. X59669 mRNA. Translation: CAA42202.1. Z30091 mRNA. Translation: CAA82907.1. |
| IPI | IPI00576712. IPI00585755. IPI00589776. IPI00594003. IPI00596996. IPI00597592. |
| PIR | I51222. I51259. S35695. |
| RefSeq | NP_990500.1. NM_205169.1. |
| UniGene | Gga.509. |
3D structure databases | |
| ProteinModelPortal | Q91044. |
| SMR | Q91044. Positions 300-401. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-127882. |
| STRING | 9031.ENSGALP00000010970. |
Protein family/group databases | |
| MEROPS | I43.001. |
Proteomic databases | |
| PaxDb | Q91044. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 396081. |
| KEGG | gga:396081. |
Organism-specific databases | |
| CTD | 4916. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG056735. |
| KO | K05101. |
Enzyme and pathway databases | |
| BRENDA | 2.7.10.1. 1306. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 2 hits. |
| InterPro | IPR000483. Cys-rich_flank_reg_C. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR011009. Kinase-like_dom. IPR001611. Leu-rich_rpt. IPR000372. LRR-contain_N. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR020446. Tyr_kin_neurotrophic_rcpt_3. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. IPR020777. Tyr_kinase_NGF_rcpt. IPR002011. Tyr_kinase_rcpt_2_CS. [Graphical view] |
| Pfam | PF07679. I-set. 2 hits. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] |
| PRINTS | PR01939. NTKRECEPTOR. PR01942. NTKRECEPTOR3. PR00109. TYRKINASE. |
| SMART | SM00409. IG. 1 hit. SM00082. LRRCT. 1 hit. SM00013. LRRNT. 1 hit. SM00219. TyrKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50835. IG_LIKE. 1 hit. PS51450. LRR. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS00239. RECEPTOR_TYR_KIN_II. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20816139. |
Entry information
| Entry name | NTRK3_CHICK | ||||||||
| Accession | Primary (citable) accession number: Q91044 Secondary accession number(s): Q91011, Q92022 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
