Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q91044

- NTRK3_CHICK

UniProt

Q91044 - NTRK3_CHICK

Protein

NT-3 growth factor receptor

Gene

NTRK3

Organism
Gallus gallus (Chicken)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 129 (01 Oct 2014)
      Sequence version 2 (15 Jul 1999)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the trk receptors are SHC1, PI-3 kinase and PLCG1. The KT and KD isoforms fail to stimulate transformation, process outgrowth or survival. Isoform KI25 exhibits tyrosine phosphorylation in the absence of ligand and is unable to mediate survival of neuronal cells.

    Catalytic activityi

    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei518 – 5181Interaction with SHC1By similarity
    Binding sitei574 – 5741ATPPROSITE-ProRule annotation
    Active sitei681 – 6811Proton acceptorPROSITE-ProRule annotation
    Sitei822 – 8221Interaction with PLC-gamma-1By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi546 – 5549ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. neurotrophin receptor activity Source: InterPro
    3. transmembrane receptor protein tyrosine kinase activity Source: UniProtKB-EC

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. nervous system development Source: UniProtKB-KW
    3. transmembrane receptor protein tyrosine kinase signaling pathway Source: InterPro

    Keywords - Molecular functioni

    Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

    Keywords - Biological processi

    Differentiation, Neurogenesis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.10.1. 1306.

    Protein family/group databases

    MEROPSiI43.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NT-3 growth factor receptor (EC:2.7.10.1)
    Alternative name(s):
    Neurotrophic tyrosine kinase receptor type 3
    TrkC tyrosine kinase
    Short name:
    Trk-C
    Gene namesi
    Name:NTRK3
    Synonyms:TRKC
    OrganismiGallus gallus (Chicken)
    Taxonomic identifieri9031 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus
    ProteomesiUP000000539: Unplaced

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: InterPro

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3131By similarityAdd
    BLAST
    Chaini32 – 827796NT-3 growth factor receptorPRO_0000016736Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi68 – 681N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi72 – 721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi79 – 791N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi203 – 2031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi218 – 2181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi259 – 2591N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi267 – 2671N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi272 – 2721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi294 – 2941N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi320 ↔ 362PROSITE-ProRule annotation
    Glycosylationi375 – 3751N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi388 – 3881N-linked (GlcNAc...)Sequence Analysis
    Modified residuei518 – 5181Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei707 – 7071Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei711 – 7111Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei712 – 7121Phosphotyrosine; by autocatalysisBy similarity
    Modified residuei822 – 8221Phosphotyrosine; by autocatalysisBy similarity

    Post-translational modificationi

    Ligand-mediated auto-phosphorylation.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ91044.

    Expressioni

    Developmental stagei

    Expression occurs in the embryonal day 2 (E2) embryo with increasing levels later in development. In the E9 embryo highest levels are found in brain and spinal cord with intermediate levels in eye, heart, gut and muscle. Low levels are found in kidney, liver, skin and yolk sac.

    Interactioni

    Subunit structurei

    Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures.

    Protein-protein interaction databases

    MINTiMINT-127882.
    STRINGi9031.ENSGALP00000010970.

    Structurei

    3D structure databases

    ProteinModelPortaliQ91044.
    SMRiQ91044. Positions 300-401.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini32 – 430399ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini456 – 827372CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei431 – 45525HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati104 – 12522LRR 1Add
    BLAST
    Repeati128 – 14922LRR 2Add
    BLAST
    Domaini160 – 20950LRRCTAdd
    BLAST
    Domaini210 – 30091Ig-like C2-type 1Add
    BLAST
    Domaini319 – 38264Ig-like C2-type 2Add
    BLAST
    Domaini540 – 812273Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
    Contains 2 LRR (leucine-rich) repeats.Curated
    Contains 1 LRRCT domain.Curated
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0515.
    HOVERGENiHBG056735.
    KOiK05101.
    PhylomeDBiQ91044.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR000483. Cys-rich_flank_reg_C.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR011009. Kinase-like_dom.
    IPR001611. Leu-rich_rpt.
    IPR000372. LRR-contain_N.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR020446. Tyr_kin_neurotrophic_rcpt_3.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    IPR020777. Tyr_kinase_NGF_rcpt.
    IPR002011. Tyr_kinase_rcpt_2_CS.
    [Graphical view]
    PfamiPF07679. I-set. 2 hits.
    PF13855. LRR_8. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view]
    PRINTSiPR01939. NTKRECEPTOR.
    PR01942. NTKRECEPTOR3.
    PR00109. TYRKINASE.
    SMARTiSM00409. IG. 1 hit.
    SM00082. LRRCT. 1 hit.
    SM00013. LRRNT. 1 hit.
    SM00219. TyrKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS50835. IG_LIKE. 1 hit.
    PS51450. LRR. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform Alpha-FL (identifier: Q91044-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDVSLCPTKC TFWRVFLLWS IWGDYLLSVL ACPANCLCSK TDINCKKPDD    50
    GNLFPLLEGQ DSGSSNGNTS INITDISRNI TSIHIENWKN LQTLNAVDME 100
    LYTGLQRLTI RNSGLRNIQP RAFAKNPHLR YIDLSGNRLT TLSWQLFQTL 150
    RLFDLRLERN PFNCSCDIRW IQLWQEKGEA NLQSQQLHCM NLDTAVILLR 200
    NMNITQCDLP EISVSHVNLT VREGENAVIT CNGSGSPLPD VDWTVADLHS 250
    INTHQTNLNW TNVHAINLTL VNVTSEDNGF LLTCIAENVV GMSNASVLLT 300
    VYYPPRILTL EEPVLHLEHC IAFAVHGNPA PTLHWLHNGQ VLRETEIIHM 350
    EFYQQGEVSE GCLLFNKPTH YNNGNYTIVA TNQLGSANQT IKGHFLEKPF 400
    PESTDNFVSI GDYEVSPTPP ITVTHKPEED TFGVSIAVGL AAFACVLLVV 450
    LFIMINKYGR RSKFGMKGPV AVISGEEDSA SPLHHINHGI TTPSSLDAGP 500
    DTVVIGMTRI PVIENPQYFR QGHNCHKPDT YVQHIKRRDI VLKRELGEGA 550
    FGKVFLAECY NLSPTNDKML VAVKALKDPT LAARKDFQRE AELLTNLQHE 600
    HIVKFYGVCG DGDPLIMVFE YMKHGDLNKF LRAHGPDAMI LVDGQPRQAK 650
    GELGLSQMLH IASQIASGMV YLASQHFVHR DLATRNCLVG ANLLVKIGDF 700
    GMSRDVYSTD YYRVGGHTML PIRWMPPESI MYRKFTTESD VWSFGVILWE 750
    IFTYGKQPWF QLSNTEVIEC ITQGRVLERP RVCPKEVYDI MLGCWQREPQ 800
    QRLNIKEIYK ILHALGKATP IYLDILG 827
    Length:827
    Mass (Da):93,181
    Last modified:July 15, 1999 - v2
    Checksum:iAB97373113DCB28A
    GO
    Isoform Alpha-KT (identifier: Q91044-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         633-664: AHGPDAMILVDGQPRQAKGELGLSQMLHIASQ → LEDTPCCLSAGCLRRASCTGSSQRRVTSGASG
         665-827: Missing.

    Show »
    Length:664
    Mass (Da):74,109
    Checksum:i11028413AB7DC850
    GO
    Isoform Alpha-KD (identifier: Q91044-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF
         620-827: Missing.

    Show »
    Length:619
    Mass (Da):69,225
    Checksum:i13E6054D108EC9E8
    GO
    Isoform Beta-KD (identifier: Q91044-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-98: Missing.
         581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF
         620-827: Missing.

    Show »
    Length:521
    Mass (Da):58,334
    Checksum:iE62888AE1B708EA1
    GO
    Isoform TRKC-3 (identifier: Q91044-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         581-599: LAARKDFQREAELLTNLQH → CFREIMLNPISLPGHCQTS
         600-827: Missing.

    Note: The kinase domain is of 19 aa instead of 39aa in the isoform alpha-KD due to a frameshift.

    Show »
    Length:599
    Mass (Da):66,934
    Checksum:iED8F7FED76FA0EA8
    GO
    Isoform KI25 (identifier: Q91044-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         713-713: R → REGPRPKGQLSTAWQRHRLAPPAAAT

    Show »
    Length:852
    Mass (Da):95,860
    Checksum:i30DEB2057E27A274
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1 – 3939MDVSL…NCLCS → MHFICWRIFASDRLKVLF(PubMed:8394830)CuratedAdd
    BLAST
    Sequence conflicti124 – 1241A → G in CAA42202. (PubMed:8394830)Curated
    Sequence conflicti378 – 3781I → F in CAA82907. (PubMed:8261614)Curated
    Sequence conflicti481 – 49616SPLHH…TPSSL → ATHTSTTDTRFVT in CAA42202. (PubMed:8394830)CuratedAdd
    BLAST
    Sequence conflicti795 – 7951W → C in CAA42202. (PubMed:8394830)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9898Missing in isoform Beta-KD. 1 PublicationVSP_002938Add
    BLAST
    Alternative sequencei581 – 61939LAARK…LIMVF → CFREIMLNPISLPGHSKPLN QGIYVEDVSVYFSKGRHGF in isoform Alpha-KD and isoform Beta-KD. 1 PublicationVSP_002939Add
    BLAST
    Alternative sequencei581 – 59919LAARK…TNLQH → CFREIMLNPISLPGHCQTS in isoform TRKC-3. 1 PublicationVSP_002941Add
    BLAST
    Alternative sequencei600 – 827228Missing in isoform TRKC-3. 1 PublicationVSP_002942Add
    BLAST
    Alternative sequencei620 – 827208Missing in isoform Alpha-KD and isoform Beta-KD. 1 PublicationVSP_002940Add
    BLAST
    Alternative sequencei633 – 66432AHGPD…HIASQ → LEDTPCCLSAGCLRRASCTG SSQRRVTSGASG in isoform Alpha-KT. 1 PublicationVSP_002943Add
    BLAST
    Alternative sequencei665 – 827163Missing in isoform Alpha-KT. 1 PublicationVSP_002944Add
    BLAST
    Alternative sequencei713 – 7131R → REGPRPKGQLSTAWQRHRLA PPAAAT in isoform KI25. 1 PublicationVSP_002945

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S74248 mRNA. Translation: AAB31699.1.
    X59669 mRNA. Translation: CAA42202.1.
    Z30091 mRNA. Translation: CAA82907.1.
    PIRiI51222.
    I51259.
    S35695.
    RefSeqiNP_990500.1. NM_205169.1. [Q91044-6]
    UniGeneiGga.509.

    Genome annotation databases

    GeneIDi396081.
    KEGGigga:396081.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S74248 mRNA. Translation: AAB31699.1 .
    X59669 mRNA. Translation: CAA42202.1 .
    Z30091 mRNA. Translation: CAA82907.1 .
    PIRi I51222.
    I51259.
    S35695.
    RefSeqi NP_990500.1. NM_205169.1. [Q91044-6 ]
    UniGenei Gga.509.

    3D structure databases

    ProteinModelPortali Q91044.
    SMRi Q91044. Positions 300-401.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    MINTi MINT-127882.
    STRINGi 9031.ENSGALP00000010970.

    Protein family/group databases

    MEROPSi I43.001.

    Proteomic databases

    PaxDbi Q91044.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 396081.
    KEGGi gga:396081.

    Organism-specific databases

    CTDi 4916.

    Phylogenomic databases

    eggNOGi COG0515.
    HOVERGENi HBG056735.
    KOi K05101.
    PhylomeDBi Q91044.

    Enzyme and pathway databases

    BRENDAi 2.7.10.1. 1306.

    Miscellaneous databases

    NextBioi 20816139.
    PROi Q91044.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR000483. Cys-rich_flank_reg_C.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR011009. Kinase-like_dom.
    IPR001611. Leu-rich_rpt.
    IPR000372. LRR-contain_N.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR020446. Tyr_kin_neurotrophic_rcpt_3.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    IPR020777. Tyr_kinase_NGF_rcpt.
    IPR002011. Tyr_kinase_rcpt_2_CS.
    [Graphical view ]
    Pfami PF07679. I-set. 2 hits.
    PF13855. LRR_8. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view ]
    PRINTSi PR01939. NTKRECEPTOR.
    PR01942. NTKRECEPTOR3.
    PR00109. TYRKINASE.
    SMARTi SM00409. IG. 1 hit.
    SM00082. LRRCT. 1 hit.
    SM00013. LRRNT. 1 hit.
    SM00219. TyrKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS50835. IG_LIKE. 1 hit.
    PS51450. LRR. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isoforms of the avian TrkC receptor: a novel kinase insertion dissociates transformation and process outgrowth from survival."
      Garner A.S., Large T.H.
      Neuron 13:457-472(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-FL; ALPHA-KT; ALPHA-KD; BETA-KD AND KI25).
      Tissue: Embryonic brain.
    2. "Molecular cloning and expression of a novel truncated form of chicken trkC."
      Okazawa H., Kamei M., Kanazawa I.
      FEBS Lett. 329:171-177(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-FL AND TRKC-3).
    3. "Molecular cloning and cellular localization of trkC in the chicken embryo."
      Williams R., Backstrom A., Ebendal T., Hallboeoek F.
      Brain Res. Dev. Brain Res. 75:235-252(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 378-513.
      Tissue: Embryo.

    Entry informationi

    Entry nameiNTRK3_CHICK
    AccessioniPrimary (citable) accession number: Q91044
    Secondary accession number(s): Q91011, Q92022
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: July 15, 1999
    Last modified: October 1, 2014
    This is version 129 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3