Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NT-3 growth factor receptor

Gene

NTRK3

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/AKT and the MAPK pathways, that control cell survival and differentiation (By similarity). The KT and KD isoforms fail to stimulate transformation, process outgrowth or survival. Isoform KI25 exhibits tyrosine phosphorylation in the absence of ligand and is unable to mediate survival of neuronal cells (PubMed:8060621).By similarity1 Publication

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei574ATPPROSITE-ProRule annotation1
Active sitei681Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi546 – 554ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Differentiation, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.10.1. 1306.

Names & Taxonomyi

Protein namesi
Recommended name:
NT-3 growth factor receptor (EC:2.7.10.1)
Alternative name(s):
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Short name:
Trk-C
Gene namesi
Name:NTRK3
Synonyms:TRKC
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Unplaced

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini32 – 430ExtracellularSequence analysisAdd BLAST399
Transmembranei431 – 455HelicalSequence analysisAdd BLAST25
Topological domaini456 – 827CytoplasmicSequence analysisAdd BLAST372

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 31By similarityAdd BLAST31
ChainiPRO_000001673632 – 827NT-3 growth factor receptorAdd BLAST796

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi68N-linked (GlcNAc...)Sequence analysis1
Glycosylationi72N-linked (GlcNAc...)Sequence analysis1
Glycosylationi79N-linked (GlcNAc...)Sequence analysis1
Glycosylationi163N-linked (GlcNAc...)Sequence analysis1
Glycosylationi203N-linked (GlcNAc...)Sequence analysis1
Glycosylationi218N-linked (GlcNAc...)Sequence analysis1
Glycosylationi232N-linked (GlcNAc...)Sequence analysis1
Glycosylationi259N-linked (GlcNAc...)Sequence analysis1
Glycosylationi267N-linked (GlcNAc...)Sequence analysis1
Glycosylationi272N-linked (GlcNAc...)Sequence analysis1
Glycosylationi294N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi320 ↔ 362PROSITE-ProRule annotation
Glycosylationi375N-linked (GlcNAc...)Sequence analysis1
Glycosylationi388N-linked (GlcNAc...)Sequence analysis1
Modified residuei518Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei707Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei711Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei712Phosphotyrosine; by autocatalysisBy similarity1
Modified residuei822Phosphotyrosine; by autocatalysisBy similarity1

Post-translational modificationi

Ligand-mediated auto-phosphorylation.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Expressioni

Developmental stagei

Expression occurs in the embryonal day 2 (E2) embryo with increasing levels later in development. In the E9 embryo highest levels are found in brain and spinal cord with intermediate levels in eye, heart, gut and muscle. Low levels are found in kidney, liver, skin and yolk sac.

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei518Interaction with SHC1By similarity1
Sitei822Interaction with PLC-gamma-1By similarity1

Protein-protein interaction databases

MINTiMINT-127882.

Structurei

Secondary structure

1827
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi40 – 45Combined sources6
Helixi60 – 62Combined sources3
Helixi70 – 78Combined sources9
Beta strandi82 – 86Combined sources5
Helixi96 – 99Combined sources4
Beta strandi107 – 113Combined sources7
Turni120 – 125Combined sources6
Beta strandi131 – 133Combined sources3
Helixi144 – 147Combined sources4
Beta strandi153 – 156Combined sources4
Helixi166 – 168Combined sources3
Helixi169 – 177Combined sources9
Helixi179 – 184Combined sources6
Beta strandi188 – 190Combined sources3
Beta strandi196 – 198Combined sources3
Helixi199 – 201Combined sources3
Beta strandi211 – 215Combined sources5
Beta strandi217 – 222Combined sources6
Beta strandi227 – 237Combined sources11
Beta strandi240 – 243Combined sources4
Beta strandi250 – 256Combined sources7
Beta strandi263 – 272Combined sources10
Helixi275 – 277Combined sources3
Beta strandi281 – 287Combined sources7
Beta strandi292 – 302Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PBVX-ray2.50A/B32-302[»]
4PBWX-ray3.05A/B/C32-302[»]
ProteinModelPortaliQ91044.
SMRiQ91044.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati104 – 125LRR 1Add BLAST22
Repeati128 – 149LRR 2Add BLAST22
Domaini160 – 209LRRCTAdd BLAST50
Domaini210 – 300Ig-like C2-type 1Add BLAST91
Domaini319 – 382Ig-like C2-type 2Add BLAST64
Domaini540 – 812Protein kinasePROSITE-ProRule annotationAdd BLAST273

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.PROSITE-ProRule annotation
Contains 2 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118818.
HOVERGENiHBG056735.
InParanoidiQ91044.
KOiK05101.
PhylomeDBiQ91044.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR013151. Immunoglobulin.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR031635. NTRK_C2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 1 hit.
PF00047. ig. 1 hit.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
PF16920. TPKR_C2. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform Alpha-FL (identifier: Q91044-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVSLCPTKC TFWRVFLLWS IWGDYLLSVL ACPANCLCSK TDINCKKPDD
60 70 80 90 100
GNLFPLLEGQ DSGSSNGNTS INITDISRNI TSIHIENWKN LQTLNAVDME
110 120 130 140 150
LYTGLQRLTI RNSGLRNIQP RAFAKNPHLR YIDLSGNRLT TLSWQLFQTL
160 170 180 190 200
RLFDLRLERN PFNCSCDIRW IQLWQEKGEA NLQSQQLHCM NLDTAVILLR
210 220 230 240 250
NMNITQCDLP EISVSHVNLT VREGENAVIT CNGSGSPLPD VDWTVADLHS
260 270 280 290 300
INTHQTNLNW TNVHAINLTL VNVTSEDNGF LLTCIAENVV GMSNASVLLT
310 320 330 340 350
VYYPPRILTL EEPVLHLEHC IAFAVHGNPA PTLHWLHNGQ VLRETEIIHM
360 370 380 390 400
EFYQQGEVSE GCLLFNKPTH YNNGNYTIVA TNQLGSANQT IKGHFLEKPF
410 420 430 440 450
PESTDNFVSI GDYEVSPTPP ITVTHKPEED TFGVSIAVGL AAFACVLLVV
460 470 480 490 500
LFIMINKYGR RSKFGMKGPV AVISGEEDSA SPLHHINHGI TTPSSLDAGP
510 520 530 540 550
DTVVIGMTRI PVIENPQYFR QGHNCHKPDT YVQHIKRRDI VLKRELGEGA
560 570 580 590 600
FGKVFLAECY NLSPTNDKML VAVKALKDPT LAARKDFQRE AELLTNLQHE
610 620 630 640 650
HIVKFYGVCG DGDPLIMVFE YMKHGDLNKF LRAHGPDAMI LVDGQPRQAK
660 670 680 690 700
GELGLSQMLH IASQIASGMV YLASQHFVHR DLATRNCLVG ANLLVKIGDF
710 720 730 740 750
GMSRDVYSTD YYRVGGHTML PIRWMPPESI MYRKFTTESD VWSFGVILWE
760 770 780 790 800
IFTYGKQPWF QLSNTEVIEC ITQGRVLERP RVCPKEVYDI MLGCWQREPQ
810 820
QRLNIKEIYK ILHALGKATP IYLDILG
Length:827
Mass (Da):93,181
Last modified:July 15, 1999 - v2
Checksum:iAB97373113DCB28A
GO
Isoform Alpha-KT (identifier: Q91044-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     633-664: AHGPDAMILVDGQPRQAKGELGLSQMLHIASQ → LEDTPCCLSAGCLRRASCTGSSQRRVTSGASG
     665-827: Missing.

Show »
Length:664
Mass (Da):74,109
Checksum:i11028413AB7DC850
GO
Isoform Alpha-KD (identifier: Q91044-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF
     620-827: Missing.

Show »
Length:619
Mass (Da):69,225
Checksum:i13E6054D108EC9E8
GO
Isoform Beta-KD (identifier: Q91044-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF
     620-827: Missing.

Show »
Length:521
Mass (Da):58,334
Checksum:iE62888AE1B708EA1
GO
Isoform TRKC-3 (identifier: Q91044-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-599: LAARKDFQREAELLTNLQH → CFREIMLNPISLPGHCQTS
     600-827: Missing.

Note: The kinase domain is of 19 aa instead of 39aa in the isoform alpha-KD due to a frameshift.
Show »
Length:599
Mass (Da):66,934
Checksum:iED8F7FED76FA0EA8
GO
Isoform KI25 (identifier: Q91044-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     713-713: R → REGPRPKGQLSTAWQRHRLAPPAAAT

Show »
Length:852
Mass (Da):95,860
Checksum:i30DEB2057E27A274
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1 – 39MDVSL…NCLCS → MHFICWRIFASDRLKVLF (PubMed:8394830).CuratedAdd BLAST39
Sequence conflicti124A → G in CAA42202 (PubMed:8394830).Curated1
Sequence conflicti378I → F in CAA82907 (PubMed:8261614).Curated1
Sequence conflicti481 – 496SPLHH…TPSSL → ATHTSTTDTRFVT in CAA42202 (PubMed:8394830).CuratedAdd BLAST16
Sequence conflicti795W → C in CAA42202 (PubMed:8394830).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0029381 – 98Missing in isoform Beta-KD. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_002939581 – 619LAARK…LIMVF → CFREIMLNPISLPGHSKPLN QGIYVEDVSVYFSKGRHGF in isoform Alpha-KD and isoform Beta-KD. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_002941581 – 599LAARK…TNLQH → CFREIMLNPISLPGHCQTS in isoform TRKC-3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_002942600 – 827Missing in isoform TRKC-3. 1 PublicationAdd BLAST228
Alternative sequenceiVSP_002940620 – 827Missing in isoform Alpha-KD and isoform Beta-KD. 1 PublicationAdd BLAST208
Alternative sequenceiVSP_002943633 – 664AHGPD…HIASQ → LEDTPCCLSAGCLRRASCTG SSQRRVTSGASG in isoform Alpha-KT. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_002944665 – 827Missing in isoform Alpha-KT. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_002945713R → REGPRPKGQLSTAWQRHRLA PPAAAT in isoform KI25. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S74248 mRNA. Translation: AAB31699.1.
X59669 mRNA. Translation: CAA42202.1.
Z30091 mRNA. Translation: CAA82907.1.
PIRiI51222.
I51259.
S35695.
RefSeqiNP_990500.1. NM_205169.1. [Q91044-6]
XP_015147467.1. XM_015291981.1. [Q91044-1]
UniGeneiGga.509.

Genome annotation databases

EnsembliENSGALT00000056594; ENSGALP00000052783; ENSGALG00000040241. [Q91044-1]
ENSGALT00000072944; ENSGALP00000049680; ENSGALG00000040241. [Q91044-6]
GeneIDi396081.
KEGGigga:396081.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S74248 mRNA. Translation: AAB31699.1.
X59669 mRNA. Translation: CAA42202.1.
Z30091 mRNA. Translation: CAA82907.1.
PIRiI51222.
I51259.
S35695.
RefSeqiNP_990500.1. NM_205169.1. [Q91044-6]
XP_015147467.1. XM_015291981.1. [Q91044-1]
UniGeneiGga.509.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PBVX-ray2.50A/B32-302[»]
4PBWX-ray3.05A/B/C32-302[»]
ProteinModelPortaliQ91044.
SMRiQ91044.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-127882.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000056594; ENSGALP00000052783; ENSGALG00000040241. [Q91044-1]
ENSGALT00000072944; ENSGALP00000049680; ENSGALG00000040241. [Q91044-6]
GeneIDi396081.
KEGGigga:396081.

Organism-specific databases

CTDi4916.

Phylogenomic databases

GeneTreeiENSGT00760000118818.
HOVERGENiHBG056735.
InParanoidiQ91044.
KOiK05101.
PhylomeDBiQ91044.

Enzyme and pathway databases

BRENDAi2.7.10.1. 1306.

Miscellaneous databases

PROiQ91044.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
3.80.10.10. 1 hit.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR013151. Immunoglobulin.
IPR011009. Kinase-like_dom.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR031635. NTRK_C2.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 1 hit.
PF00047. ig. 1 hit.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
PF16920. TPKR_C2. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
SSF52058. SSF52058. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNTRK3_CHICK
AccessioniPrimary (citable) accession number: Q91044
Secondary accession number(s): Q91011, Q92022
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 15, 1999
Last modified: November 30, 2016
This is version 146 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.