SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q91044

- NTRK3_CHICK

UniProt

Q91044 - NTRK3_CHICK

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

NT-3 growth factor receptor

Gene
NTRK3, TRKC
Organism
Gallus gallus (Chicken)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Receptor for neurotrophin-3 (NT-3). This is a tyrosine-protein kinase receptor. Known substrates for the trk receptors are SHC1, PI-3 kinase and PLCG1. The KT and KD isoforms fail to stimulate transformation, process outgrowth or survival. Isoform KI25 exhibits tyrosine phosphorylation in the absence of ligand and is unable to mediate survival of neuronal cells.

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei518 – 5181Interaction with SHC1 By similarity
Binding sitei574 – 5741ATP By similarity
Active sitei681 – 6811Proton acceptor By similarity
Sitei822 – 8221Interaction with PLC-gamma-1 By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi546 – 5549ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. neurotrophin receptor activity Source: InterPro
  3. transmembrane receptor protein tyrosine kinase activity Source: UniProtKB-EC

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. nervous system development Source: UniProtKB-KW
  3. transmembrane receptor protein tyrosine kinase signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Differentiation, Neurogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.10.1. 1306.

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
NT-3 growth factor receptor (EC:2.7.10.1)
Alternative name(s):
Neurotrophic tyrosine kinase receptor type 3
TrkC tyrosine kinase
Short name:
Trk-C
Gene namesi
Name:NTRK3
Synonyms:TRKC
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus
ProteomesiUP000000539: Unplaced

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini32 – 430399Extracellular Reviewed predictionAdd
BLAST
Transmembranei431 – 45525Helical; Reviewed predictionAdd
BLAST
Topological domaini456 – 827372Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131 By similarityAdd
BLAST
Chaini32 – 827796NT-3 growth factor receptorPRO_0000016736Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi68 – 681N-linked (GlcNAc...) Reviewed prediction
Glycosylationi72 – 721N-linked (GlcNAc...) Reviewed prediction
Glycosylationi79 – 791N-linked (GlcNAc...) Reviewed prediction
Glycosylationi163 – 1631N-linked (GlcNAc...) Reviewed prediction
Glycosylationi203 – 2031N-linked (GlcNAc...) Reviewed prediction
Glycosylationi218 – 2181N-linked (GlcNAc...) Reviewed prediction
Glycosylationi232 – 2321N-linked (GlcNAc...) Reviewed prediction
Glycosylationi259 – 2591N-linked (GlcNAc...) Reviewed prediction
Glycosylationi267 – 2671N-linked (GlcNAc...) Reviewed prediction
Glycosylationi272 – 2721N-linked (GlcNAc...) Reviewed prediction
Glycosylationi294 – 2941N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi320 ↔ 362 By similarity
Glycosylationi375 – 3751N-linked (GlcNAc...) Reviewed prediction
Glycosylationi388 – 3881N-linked (GlcNAc...) Reviewed prediction
Modified residuei518 – 5181Phosphotyrosine; by autocatalysis By similarity
Modified residuei707 – 7071Phosphotyrosine; by autocatalysis By similarity
Modified residuei711 – 7111Phosphotyrosine; by autocatalysis By similarity
Modified residuei712 – 7121Phosphotyrosine; by autocatalysis By similarity
Modified residuei822 – 8221Phosphotyrosine; by autocatalysis By similarity

Post-translational modificationi

Ligand-mediated auto-phosphorylation By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ91044.

Expressioni

Developmental stagei

Expression occurs in the embryonal day 2 (E2) embryo with increasing levels later in development. In the E9 embryo highest levels are found in brain and spinal cord with intermediate levels in eye, heart, gut and muscle. Low levels are found in kidney, liver, skin and yolk sac.

Interactioni

Subunit structurei

Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures.

Protein-protein interaction databases

MINTiMINT-127882.
STRINGi9031.ENSGALP00000010970.

Structurei

3D structure databases

ProteinModelPortaliQ91044.
SMRiQ91044. Positions 300-401.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati104 – 12522LRR 1Add
BLAST
Repeati128 – 14922LRR 2Add
BLAST
Domaini160 – 20950LRRCTAdd
BLAST
Domaini210 – 30091Ig-like C2-type 1Add
BLAST
Domaini319 – 38264Ig-like C2-type 2Add
BLAST
Domaini540 – 812273Protein kinaseAdd
BLAST

Sequence similaritiesi

Contains 1 LRRCT domain.

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0515.
HOVERGENiHBG056735.
KOiK05101.
PhylomeDBiQ91044.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view]
PfamiPF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTiSM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform Alpha-FL (identifier: Q91044-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDVSLCPTKC TFWRVFLLWS IWGDYLLSVL ACPANCLCSK TDINCKKPDD    50
GNLFPLLEGQ DSGSSNGNTS INITDISRNI TSIHIENWKN LQTLNAVDME 100
LYTGLQRLTI RNSGLRNIQP RAFAKNPHLR YIDLSGNRLT TLSWQLFQTL 150
RLFDLRLERN PFNCSCDIRW IQLWQEKGEA NLQSQQLHCM NLDTAVILLR 200
NMNITQCDLP EISVSHVNLT VREGENAVIT CNGSGSPLPD VDWTVADLHS 250
INTHQTNLNW TNVHAINLTL VNVTSEDNGF LLTCIAENVV GMSNASVLLT 300
VYYPPRILTL EEPVLHLEHC IAFAVHGNPA PTLHWLHNGQ VLRETEIIHM 350
EFYQQGEVSE GCLLFNKPTH YNNGNYTIVA TNQLGSANQT IKGHFLEKPF 400
PESTDNFVSI GDYEVSPTPP ITVTHKPEED TFGVSIAVGL AAFACVLLVV 450
LFIMINKYGR RSKFGMKGPV AVISGEEDSA SPLHHINHGI TTPSSLDAGP 500
DTVVIGMTRI PVIENPQYFR QGHNCHKPDT YVQHIKRRDI VLKRELGEGA 550
FGKVFLAECY NLSPTNDKML VAVKALKDPT LAARKDFQRE AELLTNLQHE 600
HIVKFYGVCG DGDPLIMVFE YMKHGDLNKF LRAHGPDAMI LVDGQPRQAK 650
GELGLSQMLH IASQIASGMV YLASQHFVHR DLATRNCLVG ANLLVKIGDF 700
GMSRDVYSTD YYRVGGHTML PIRWMPPESI MYRKFTTESD VWSFGVILWE 750
IFTYGKQPWF QLSNTEVIEC ITQGRVLERP RVCPKEVYDI MLGCWQREPQ 800
QRLNIKEIYK ILHALGKATP IYLDILG 827
Length:827
Mass (Da):93,181
Last modified:July 15, 1999 - v2
Checksum:iAB97373113DCB28A
GO
Isoform Alpha-KT (identifier: Q91044-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     633-664: AHGPDAMILVDGQPRQAKGELGLSQMLHIASQ → LEDTPCCLSAGCLRRASCTGSSQRRVTSGASG
     665-827: Missing.

Show »
Length:664
Mass (Da):74,109
Checksum:i11028413AB7DC850
GO
Isoform Alpha-KD (identifier: Q91044-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF
     620-827: Missing.

Show »
Length:619
Mass (Da):69,225
Checksum:i13E6054D108EC9E8
GO
Isoform Beta-KD (identifier: Q91044-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     581-619: LAARKDFQRE...GDGDPLIMVF → CFREIMLNPI...VYFSKGRHGF
     620-827: Missing.

Show »
Length:521
Mass (Da):58,334
Checksum:iE62888AE1B708EA1
GO
Isoform TRKC-3 (identifier: Q91044-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-599: LAARKDFQREAELLTNLQH → CFREIMLNPISLPGHCQTS
     600-827: Missing.

Note: The kinase domain is of 19 aa instead of 39aa in the isoform alpha-KD due to a frameshift.

Show »
Length:599
Mass (Da):66,934
Checksum:iED8F7FED76FA0EA8
GO
Isoform KI25 (identifier: Q91044-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     713-713: R → REGPRPKGQLSTAWQRHRLAPPAAAT

Show »
Length:852
Mass (Da):95,860
Checksum:i30DEB2057E27A274
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9898Missing in isoform Beta-KD. VSP_002938Add
BLAST
Alternative sequencei581 – 61939LAARK…LIMVF → CFREIMLNPISLPGHSKPLN QGIYVEDVSVYFSKGRHGF in isoform Alpha-KD and isoform Beta-KD. VSP_002939Add
BLAST
Alternative sequencei581 – 59919LAARK…TNLQH → CFREIMLNPISLPGHCQTS in isoform TRKC-3. VSP_002941Add
BLAST
Alternative sequencei600 – 827228Missing in isoform TRKC-3. VSP_002942Add
BLAST
Alternative sequencei620 – 827208Missing in isoform Alpha-KD and isoform Beta-KD. VSP_002940Add
BLAST
Alternative sequencei633 – 66432AHGPD…HIASQ → LEDTPCCLSAGCLRRASCTG SSQRRVTSGASG in isoform Alpha-KT. VSP_002943Add
BLAST
Alternative sequencei665 – 827163Missing in isoform Alpha-KT. VSP_002944Add
BLAST
Alternative sequencei713 – 7131R → REGPRPKGQLSTAWQRHRLA PPAAAT in isoform KI25. VSP_002945

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1 – 3939MDVSL…NCLCS → MHFICWRIFASDRLKVLF1 PublicationAdd
BLAST
Sequence conflicti124 – 1241A → G in CAA42202. 1 Publication
Sequence conflicti378 – 3781I → F in CAA82907. 1 Publication
Sequence conflicti481 – 49616SPLHH…TPSSL → ATHTSTTDTRFVT in CAA42202. 1 PublicationAdd
BLAST
Sequence conflicti795 – 7951W → C in CAA42202. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
S74248 mRNA. Translation: AAB31699.1.
X59669 mRNA. Translation: CAA42202.1.
Z30091 mRNA. Translation: CAA82907.1.
PIRiI51222.
I51259.
S35695.
RefSeqiNP_990500.1. NM_205169.1. [Q91044-6]
UniGeneiGga.509.

Genome annotation databases

GeneIDi396081.
KEGGigga:396081.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
S74248 mRNA. Translation: AAB31699.1 .
X59669 mRNA. Translation: CAA42202.1 .
Z30091 mRNA. Translation: CAA82907.1 .
PIRi I51222.
I51259.
S35695.
RefSeqi NP_990500.1. NM_205169.1. [Q91044-6 ]
UniGenei Gga.509.

3D structure databases

ProteinModelPortali Q91044.
SMRi Q91044. Positions 300-401.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

MINTi MINT-127882.
STRINGi 9031.ENSGALP00000010970.

Protein family/group databases

MEROPSi I43.001.

Proteomic databases

PaxDbi Q91044.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 396081.
KEGGi gga:396081.

Organism-specific databases

CTDi 4916.

Phylogenomic databases

eggNOGi COG0515.
HOVERGENi HBG056735.
KOi K05101.
PhylomeDBi Q91044.

Enzyme and pathway databases

BRENDAi 2.7.10.1. 1306.

Miscellaneous databases

NextBioi 20816139.
PROi Q91044.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR001611. Leu-rich_rpt.
IPR000372. LRR-contain_N.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR020446. Tyr_kin_neurotrophic_rcpt_3.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR020777. Tyr_kinase_NGF_rcpt.
IPR002011. Tyr_kinase_rcpt_2_CS.
[Graphical view ]
Pfami PF07679. I-set. 2 hits.
PF13855. LRR_8. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view ]
PRINTSi PR01939. NTKRECEPTOR.
PR01942. NTKRECEPTOR3.
PR00109. TYRKINASE.
SMARTi SM00409. IG. 1 hit.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS50835. IG_LIKE. 1 hit.
PS51450. LRR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00239. RECEPTOR_TYR_KIN_II. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Isoforms of the avian TrkC receptor: a novel kinase insertion dissociates transformation and process outgrowth from survival."
    Garner A.S., Large T.H.
    Neuron 13:457-472(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-FL; ALPHA-KT; ALPHA-KD; BETA-KD AND KI25).
    Tissue: Embryonic brain.
  2. "Molecular cloning and expression of a novel truncated form of chicken trkC."
    Okazawa H., Kamei M., Kanazawa I.
    FEBS Lett. 329:171-177(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-FL AND TRKC-3).
  3. "Molecular cloning and cellular localization of trkC in the chicken embryo."
    Williams R., Backstrom A., Ebendal T., Hallboeoek F.
    Brain Res. Dev. Brain Res. 75:235-252(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 378-513.
    Tissue: Embryo.

Entry informationi

Entry nameiNTRK3_CHICK
AccessioniPrimary (citable) accession number: Q91044
Secondary accession number(s): Q91011, Q92022
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 15, 1999
Last modified: May 14, 2014
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi