Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger CCHC domain-containing protein 14

Gene

ZCCHC14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri906 – 92318CCHC-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger CCHC domain-containing protein 14
Alternative name(s):
BDG-29
Gene namesi
Name:ZCCHC14
Synonyms:KIAA0579
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:24134. ZCCHC14.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134895795.

Polymorphism and mutation databases

BioMutaiZCCHC14.
DMDMi67462073.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 949949Zinc finger CCHC domain-containing protein 14PRO_0000150975Add
BLAST

Proteomic databases

EPDiQ8WYQ9.
MaxQBiQ8WYQ9.
PaxDbiQ8WYQ9.
PRIDEiQ8WYQ9.

PTM databases

iPTMnetiQ8WYQ9.
PhosphoSiteiQ8WYQ9.

Expressioni

Gene expression databases

BgeeiQ8WYQ9.
CleanExiHS_ZCCHC14.
ExpressionAtlasiQ8WYQ9. baseline and differential.
GenevisibleiQ8WYQ9. HS.

Organism-specific databases

HPAiHPA013572.

Interactioni

Protein-protein interaction databases

BioGridi116786. 6 interactions.
IntActiQ8WYQ9. 1 interaction.
STRINGi9606.ENSP00000268616.

Structurei

3D structure databases

ProteinModelPortaliQ8WYQ9.
SMRiQ8WYQ9. Positions 895-925.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi29 – 379Poly-Gly
Compositional biasi420 – 4256Poly-Ser
Compositional biasi704 – 74744Ser-richAdd
BLAST
Compositional biasi748 – 7514Poly-Gly
Compositional biasi763 – 7697His-rich
Compositional biasi772 – 78312Poly-ProAdd
BLAST

Sequence similaritiesi

Contains 1 CCHC-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri906 – 92318CCHC-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3791. Eukaryota.
KOG4400. Eukaryota.
ENOG410ZTU4. LUCA.
GeneTreeiENSGT00520000055637.
HOGENOMiHOG000236329.
HOVERGENiHBG080706.
InParanoidiQ8WYQ9.
OMAiCLNPSAP.
OrthoDBiEOG75TMB7.
PhylomeDBiQ8WYQ9.
TreeFamiTF335574.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
3.30.1520.10. 1 hit.
4.10.60.10. 1 hit.
InterProiIPR001683. Phox.
IPR013761. SAM/pointed.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00098. zf-CCHC. 1 hit.
[Graphical view]
SMARTiSM00343. ZnF_C2HC. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
SSF57756. SSF57756. 1 hit.
SSF64268. SSF64268. 1 hit.
PROSITEiPS50158. ZF_CCHC. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WYQ9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASNHPAFSF HQKQVLRQEL TQIQSSLNGG GGHGGKGAPG PGGALPTCPA
60 70 80 90 100
CHKITPRTEA PVSSVSNSLE NALHTSAHST EESLPKRPLG KHSKVSVEKI
110 120 130 140 150
DLKGLSHTKN DRNVECSFEV LWSDSSITSV TKSSSEVTEF ISKLCQLYPE
160 170 180 190 200
ENLEKLIPCL AGPDAFYVER NHVDLDSGLR YLASLPSHVL KNDHVRRFLS
210 220 230 240 250
TSSPPQQLQS PSPGNPSLSK VGTVMGVSGR PVCGVAGIPS SQSGAQHHGQ
260 270 280 290 300
HPAGSAAPLP HCSHAGSAGS ALAYRTQMDT SPAILMPSSL QTPQTQEQNG
310 320 330 340 350
ILDWLRKLRL HKYYPVFKQL SMEKFLSLTE EDLNKFESLT MGAKKKLKTQ
360 370 380 390 400
LELEKEKSER RCLNPSAPPL VTSSGVARVP PTSHVGPVQS GRGSHAAELR
410 420 430 440 450
VEVEQPHHQL PREGSSSEYS SSSSSPMGVQ AREESSDSAE ENDRRVEIHL
460 470 480 490 500
ESSDKEKPVM LLNHFTSSSA RPTAQVLPVQ NEASSNPSGH HPLPPQMLSA
510 520 530 540 550
ASHITPIRML NSVHKPERGS ADMKLLSSSV HSLLSLEERN KGSGPRSSMK
560 570 580 590 600
VDKSFGSAMM DVLPASAPHQ PVQVLSGLSE SSSMSPTVSF GPRTKVVHAS
610 620 630 640 650
TLDRVLKTAQ QPALVVETST AATGTPSTVL HAARPPIKLL LSSSVPADSA
660 670 680 690 700
ISGQTSCPNN VQISVPPAII NPRTALYTAN TKVAFSAMSS MPVGPLQGGF
710 720 730 740 750
CANSNTASPS SHPSTSFANM ATLPSCPAPS SSPALSSVPE SSFYSSSGGG
760 770 780 790 800
GSTGNIPASN PNHHHHHHHQ QPPAPPQPAP PPPGCIVCTS CGCSGSCGSS
810 820 830 840 850
GLTVSYANYF QHPFSGPSVF TFPFLPFSPM CSSGYVSAQQ YGGGSTFPVV
860 870 880 890 900
HAPYSSSGTP DPVLSGQSTF AVPPMQNFMA GTAGVYQTQG LVGSSNGSSH
910 920 930 940
KKSGNLSCYN CGATGHRAQD CKQPSMDFNR PGTFRLKYAP PAESLDSTD
Length:949
Mass (Da):100,042
Last modified:March 1, 2002 - v1
Checksum:i6770937387359D14
GO
Isoform 2 (identifier: Q8WYQ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     933-949: TFRLKYAPPAESLDSTD → KRAPWPRPPGSRRTSAHKCLVFMKSKLLSL

Note: No experimental confirmation available.
Show »
Length:962
Mass (Da):101,580
Checksum:iDC7CF77DAC104B06
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti54 – 541I → V.
Corresponds to variant rs11648852 [ dbSNP | Ensembl ].
VAR_053754
Natural varianti244 – 2441G → A.
Corresponds to variant rs13338940 [ dbSNP | Ensembl ].
VAR_053755
Natural varianti290 – 2901L → V in a breast cancer sample; somatic mutation. 1 Publication
VAR_036492
Natural varianti693 – 6931V → M.1 Publication
Corresponds to variant rs3748400 [ dbSNP | Ensembl ].
VAR_024703

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei933 – 94917TFRLK…LDSTD → KRAPWPRPPGSRRTSAHKCL VFMKSKLLSL in isoform 2. 1 PublicationVSP_013843Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030243 mRNA. Translation: BAB83129.1.
CH471114 Genomic DNA. Translation: EAW95389.1.
CH471114 Genomic DNA. Translation: EAW95390.1.
BC101478 mRNA. Translation: AAI01479.1.
AB011151 mRNA. Translation: BAA25505.2.
AL117532 mRNA. Translation: CAB55981.1.
CCDSiCCDS10961.1. [Q8WYQ9-1]
PIRiT17291.
RefSeqiNP_055959.1. NM_015144.2. [Q8WYQ9-1]
XP_005255915.2. XM_005255858.3. [Q8WYQ9-2]
UniGeneiHs.156231.

Genome annotation databases

EnsembliENST00000268616; ENSP00000268616; ENSG00000140948. [Q8WYQ9-1]
ENST00000568020; ENSP00000455431; ENSG00000140948. [Q8WYQ9-1]
GeneIDi23174.
KEGGihsa:23174.
UCSCiuc002fjz.2. human. [Q8WYQ9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030243 mRNA. Translation: BAB83129.1.
CH471114 Genomic DNA. Translation: EAW95389.1.
CH471114 Genomic DNA. Translation: EAW95390.1.
BC101478 mRNA. Translation: AAI01479.1.
AB011151 mRNA. Translation: BAA25505.2.
AL117532 mRNA. Translation: CAB55981.1.
CCDSiCCDS10961.1. [Q8WYQ9-1]
PIRiT17291.
RefSeqiNP_055959.1. NM_015144.2. [Q8WYQ9-1]
XP_005255915.2. XM_005255858.3. [Q8WYQ9-2]
UniGeneiHs.156231.

3D structure databases

ProteinModelPortaliQ8WYQ9.
SMRiQ8WYQ9. Positions 895-925.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116786. 6 interactions.
IntActiQ8WYQ9. 1 interaction.
STRINGi9606.ENSP00000268616.

PTM databases

iPTMnetiQ8WYQ9.
PhosphoSiteiQ8WYQ9.

Polymorphism and mutation databases

BioMutaiZCCHC14.
DMDMi67462073.

Proteomic databases

EPDiQ8WYQ9.
MaxQBiQ8WYQ9.
PaxDbiQ8WYQ9.
PRIDEiQ8WYQ9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000268616; ENSP00000268616; ENSG00000140948. [Q8WYQ9-1]
ENST00000568020; ENSP00000455431; ENSG00000140948. [Q8WYQ9-1]
GeneIDi23174.
KEGGihsa:23174.
UCSCiuc002fjz.2. human. [Q8WYQ9-1]

Organism-specific databases

CTDi23174.
GeneCardsiZCCHC14.
H-InvDBHIX0013322.
HGNCiHGNC:24134. ZCCHC14.
HPAiHPA013572.
neXtProtiNX_Q8WYQ9.
PharmGKBiPA134895795.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3791. Eukaryota.
KOG4400. Eukaryota.
ENOG410ZTU4. LUCA.
GeneTreeiENSGT00520000055637.
HOGENOMiHOG000236329.
HOVERGENiHBG080706.
InParanoidiQ8WYQ9.
OMAiCLNPSAP.
OrthoDBiEOG75TMB7.
PhylomeDBiQ8WYQ9.
TreeFamiTF335574.

Miscellaneous databases

ChiTaRSiZCCHC14. human.
GenomeRNAii23174.
PROiQ8WYQ9.

Gene expression databases

BgeeiQ8WYQ9.
CleanExiHS_ZCCHC14.
ExpressionAtlasiQ8WYQ9. baseline and differential.
GenevisibleiQ8WYQ9. HS.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
3.30.1520.10. 1 hit.
4.10.60.10. 1 hit.
InterProiIPR001683. Phox.
IPR013761. SAM/pointed.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00098. zf-CCHC. 1 hit.
[Graphical view]
SMARTiSM00343. ZnF_C2HC. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
SSF57756. SSF57756. 1 hit.
SSF64268. SSF64268. 1 hit.
PROSITEiPS50158. ZF_CCHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterization of a novel downstream gene of beta-catenin."
    Kawasoe T., Furukawa Y., Daigo Y., Ishiguro H., Nishiwaki T., Fujita M., Nagasawa Y., Miyoshi Y., Nakamura Y.
    Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-693.
    Tissue: Brain.
  4. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 40-949 (ISOFORM 1).
    Tissue: Brain.
  5. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 118-949 (ISOFORM 2).
    Tissue: Testis.
  7. Cited for: VARIANT [LARGE SCALE ANALYSIS] VAL-290.

Entry informationi

Entry nameiZCH14_HUMAN
AccessioniPrimary (citable) accession number: Q8WYQ9
Secondary accession number(s): D3DUN1
, O60324, Q3MJD8, Q9UFP0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: March 1, 2002
Last modified: June 8, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.