Reviewed,
UniProtKB/Swiss-Prot Q8WYQ4 (CV015_HUMAN)
Last modified
November 24, 2009.
Version 39.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Uncharacterized protein C22orf15 Alternative name(s): N27C7-3 protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 148 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WYQ4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WYQ4-2) The sequence of this isoform differs from the canonical sequence as follows: 84-84: K → SKVAQE 109-148: EELRRLSGLSSVGHNWRKRMGTRRGRHEQSPTSRPRKGPD → GANRQQPSRTPLAESGIAEKLHQQEGQGP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 148 | 148 | Uncharacterized protein C22orf15 | PRO_0000079576 | |||||
Natural variations | |||||||||
| Alternative sequence | 84 | 1 | K → SKVAQE in isoform 2. | VSP_014462 | |||||
| Alternative sequence | 109 – 148 | 40 | EELRR…RKGPD → GANRQQPSRTPLAESGIAEK LHQQEGQGP in isoform 2. | VSP_014463 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of N27C7-3 gene." Shimizu N., Minosima S., Kawasaki K., Sasaki T., Hosono K. Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed: 10591208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
Cross-references
Sequence databases | |
|---|---|
| AB050773 Genomic DNA. Translation: BAB83035.1. CR456371 mRNA. Translation: CAG30257.1. AP000348 Genomic DNA. No translation available. AP000349 Genomic DNA. No translation available. | |
| IPI | IPI00103766. IPI00607803. |
| RefSeq | NP_872326.2. |
| UniGene | Hs.116254 |
3D structure databases | |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q8WYQ4. |
Genome annotation databases | |
| Ensembl | ENST00000402217; ENSP00000384965; ENSG00000169314; Homo sapiens. [Genome view] |
| GeneID | 150248. |
| KEGG | hsa:150248. |
| UCSC | uc002zxu.1. human. |
Organism-specific databases | |
| CTD | 150248. |
| GeneCards | GC22P022431. |
| HGNC | HGNC:15558. C22orf15. |
| HPA | HPA018006. HPA019494. |
| PharmGKB | PA134933953. |
| GenAtlas | Search... |
Phylogenomic databases | |
| OMA | EQGPPSR. |
| OrthoDB | EOG9RR940. |
Enzyme and pathway databases | |
| BioCyc | CATTLE:ENSBTAG00000022030-MON. |
Gene expression databases | |
| ArrayExpress | Q8WYQ4. |
| Bgee | Q8WYQ4. |
| CleanEx | HS_C22orf15. |
| Genevestigator | Q8WYQ4. |
| GermOnline | ENSG00000169314. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Entry information
| Entry name | CV015_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WYQ4 Secondary accession number(s): Q6ICJ7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |

Clusters with


