Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WYA0

- IFT81_HUMAN

UniProt

Q8WYA0 - IFT81_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Intraflagellar transport protein 81 homolog

Gene

IFT81

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of the intraflagellar transport (IFT) complex B: together with IFT74, forms a tubulin-binding module that specifically mediates transport of tubulin within the cilium. Binds tubulin via its CH (calponin-homology)-like region. Required for ciliogenesis.1 Publication

GO - Molecular functioni

  1. tubulin binding Source: UniProtKB

GO - Biological processi

  1. cilium assembly Source: UniProtKB
  2. intraciliary transport involved in cilium morphogenesis Source: UniProtKB
  3. spermatogenesis Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cilium biogenesis/degradation

Names & Taxonomyi

Protein namesi
Recommended name:
Intraflagellar transport protein 81 homolog
Alternative name(s):
Carnitine deficiency-associated protein expressed in ventricle 1
Short name:
CDV-1
Gene namesi
Name:IFT81
Synonyms:CDV1
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:14313. IFT81.

Subcellular locationi

Cell projectioncilium 1 Publication

GO - Cellular componenti

  1. centrosome Source: RefGenome
  2. cilium Source: RefGenome
  3. intraciliary transport particle B Source: BHF-UCL
  4. motile cilium Source: BHF-UCL
  5. sperm midpiece Source: Ensembl
  6. sperm principal piece Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi73 – 753KYK → EYE: Abolishes tubulin-binding and impaired ciliogenesis; when associated with 113-E-E-114. 1 Publication
Mutagenesisi113 – 1142KK → EE: Abolishes tubulin-binding and impaired ciliogenesis; when associated with 73-E--E-75. 1 Publication

Organism-specific databases

PharmGKBiPA26349.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 676675Intraflagellar transport protein 81 homologPRO_0000020916Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserine1 Publication
Modified residuei61 – 611Phosphothreonine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ8WYA0.
PaxDbiQ8WYA0.
PRIDEiQ8WYA0.

PTM databases

PhosphoSiteiQ8WYA0.

Expressioni

Tissue specificityi

Highly expressed in testis, moderately in ovary, heart, liver, skeletal muscle, kidney and pancreas, low in prostate, brain, placenta and lung and not detected in spleen, thymus, small intestine and colon. Isoform CDV-1R is abundantly expressed in testis.1 Publication

Gene expression databases

BgeeiQ8WYA0.
CleanExiHS_IFT81.
ExpressionAtlasiQ8WYA0. baseline and differential.
GenevestigatoriQ8WYA0.

Organism-specific databases

HPAiHPA019087.
HPA020051.

Interactioni

Subunit structurei

Component of the IFT complex B, at least composed of IFT20, IFT22, HSPB11/IFT25, IFT27, IFT46, IFT52, TRAF3IP1/IFT54, IFT57, IFT74, IFT80, IFT81, and IFT88. Interacts with IFT74; the interaction is direct: within the IFT complex B, IFT74 and IFT81 mediate the transport of tubulin within the cilium. Interacts with tubulin; the interaction is direct. Interacts with RABL2/RABL2A; binding is equal in the presence of GTP or GDP. Interacts with IFT88.2 Publications

Protein-protein interaction databases

BioGridi118802. 14 interactions.
STRINGi9606.ENSP00000242591.

Structurei

3D structure databases

ProteinModelPortaliQ8WYA0.
SMRiQ8WYA0. Positions 5-122.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni2 – 121120CH (calponin-homology)-like regionAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili132 – 258127Sequence AnalysisAdd
BLAST
Coiled coili306 – 38984Sequence AnalysisAdd
BLAST
Coiled coili416 – 45641Sequence AnalysisAdd
BLAST
Coiled coili490 – 622133Sequence AnalysisAdd
BLAST

Domaini

The CH (calponin-homology)-like region shows high similarity to a CH (calponin-homology) domain and mediated binding to the globular domain of tubulin.1 Publication

Sequence similaritiesi

Belongs to the IFT81 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG77882.
GeneTreeiENSGT00390000000999.
HOGENOMiHOG000237323.
HOVERGENiHBG048817.
InParanoidiQ8WYA0.
OMAiYPVLHWL.
OrthoDBiEOG7JHM54.
PhylomeDBiQ8WYA0.
TreeFamiTF314635.

Family and domain databases

InterProiIPR029600. IFT81.
[Graphical view]
PANTHERiPTHR15614. PTHR15614. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing and alternative initiation. Align

Isoform CDV-1R2 Publications (identifier: Q8WYA0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDQIKFIMD SLNKEPFRKN YNLITFDSLE PMQLLQVLSD VLAEIDPKQL
60 70 80 90 100
VDIREEMPEQ TAKRMLSLLG ILKYKPSGNA TDMSTFRQGL VIGSKPVIYP
110 120 130 140 150
VLHWLLQRTN ELKKRAYLAR FLIKLEVPSE FLQDETVADT NKQYEELMEA
160 170 180 190 200
FKTLHKEYEQ LKISGFSTAE IRKDISAMEE EKDQLIKRVE HLKKRVETAQ
210 220 230 240 250
NHQWMLKIAR QLRVEKEREE YLAQQKQEQK NQLFHAVQRL QRVQNQLKSM
260 270 280 290 300
RQAAADAKPE SLMKRLEEEI KFNLYMVTEK FPKELENKKK ELHFLQKVVS
310 320 330 340 350
EPAMGHSDLL ELESKINEIN TEINQLIEKK MMRNEPIEGK LSLYRQQASI
360 370 380 390 400
ISRKKEAKAE ELQEAKEKLA SLEREASVKR NQTREFDGTE VLKGDEFKRY
410 420 430 440 450
VNKLRSKSTV FKKKHQIIAE LKAEFGLLQR TEELLKQRHE NIQQQLQTME
460 470 480 490 500
EKKGISGYSY TQEELERVSA LKSEVDEMKG RTLDDMSEMV KKLYSLVSEK
510 520 530 540 550
KSALASVIKE LRQLRQKYQE LTQECDEKKS QYDSCAAGLE SNRSKLEQEV
560 570 580 590 600
RRLREECLQE ESRYHYTNCM IKNLEVQLRR ATDEMKAYIS SDQQEKRKAI
610 620 630 640 650
REQYTKNTAE QENLGKKLRE KQKVIRESHG PNMKQAKMWR DLEQLMECKK
660 670
QCFLKQQSQT SIGQVIQEGG EDRLIL
Length:676
Mass (Da):79,746
Last modified:March 1, 2002 - v1
Checksum:iE5EBD887A6BF953E
GO
Isoform 2Curated (identifier: Q8WYA0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-431: FKRYVNKLRSKSTVFKKKHQIIAELKAEFGLLQRT → RQDLTLSPRLECGGVIMAYCSLKLLGSSDPPTSAS
     432-676: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:431
Mass (Da):50,241
Checksum:iD6C78C86420CE32C
GO
Isoform CDV-1 (identifier: Q8WYA0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-569: Missing.

Note: Produced by alternative initiation at Met-570 of isoform CDV-1R.

Show »
Length:107
Mass (Da):12,667
Checksum:i2721396F751403AC
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti59 – 591E → K in BAC03690. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 569569Missing in isoform CDV-1. 2 PublicationsVSP_018784Add
BLAST
Alternative sequencei397 – 43135FKRYV…LLQRT → RQDLTLSPRLECGGVIMAYC SLKLLGSSDPPTSAS in isoform 2. 1 PublicationVSP_050695Add
BLAST
Alternative sequencei432 – 676245Missing in isoform 2. 1 PublicationVSP_050696Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF250326 mRNA. Translation: AAL50343.1.
AF332010 mRNA. Translation: AAO32947.1.
AF139540 mRNA. Translation: AAP97269.1.
AF078932 mRNA. Translation: AAD48091.1.
CH471054 Genomic DNA. Translation: EAW97898.1.
BC004536 mRNA. Translation: AAH04536.2.
BC029349 mRNA. Translation: AAH29349.1.
BC108257 mRNA. Translation: AAI08258.1.
AK091549 mRNA. Translation: BAC03690.1. Sequence problems.
CCDSiCCDS41831.1. [Q8WYA0-1]
CCDS9142.1. [Q8WYA0-3]
RefSeqiNP_001137251.1. NM_001143779.1. [Q8WYA0-1]
NP_054774.2. NM_014055.3. [Q8WYA0-1]
NP_113661.2. NM_031473.3. [Q8WYA0-3]
UniGeneiHs.528382.

Genome annotation databases

GeneIDi28981.
KEGGihsa:28981.
UCSCiuc001tqg.3. human. [Q8WYA0-3]
uc001tqh.3. human. [Q8WYA0-1]

Polymorphism databases

DMDMi48474907.

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF250326 mRNA. Translation: AAL50343.1 .
AF332010 mRNA. Translation: AAO32947.1 .
AF139540 mRNA. Translation: AAP97269.1 .
AF078932 mRNA. Translation: AAD48091.1 .
CH471054 Genomic DNA. Translation: EAW97898.1 .
BC004536 mRNA. Translation: AAH04536.2 .
BC029349 mRNA. Translation: AAH29349.1 .
BC108257 mRNA. Translation: AAI08258.1 .
AK091549 mRNA. Translation: BAC03690.1 . Sequence problems.
CCDSi CCDS41831.1. [Q8WYA0-1 ]
CCDS9142.1. [Q8WYA0-3 ]
RefSeqi NP_001137251.1. NM_001143779.1. [Q8WYA0-1 ]
NP_054774.2. NM_014055.3. [Q8WYA0-1 ]
NP_113661.2. NM_031473.3. [Q8WYA0-3 ]
UniGenei Hs.528382.

3D structure databases

ProteinModelPortali Q8WYA0.
SMRi Q8WYA0. Positions 5-122.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 118802. 14 interactions.
STRINGi 9606.ENSP00000242591.

PTM databases

PhosphoSitei Q8WYA0.

Polymorphism databases

DMDMi 48474907.

Proteomic databases

MaxQBi Q8WYA0.
PaxDbi Q8WYA0.
PRIDEi Q8WYA0.

Protocols and materials databases

DNASUi 28981.
Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 28981.
KEGGi hsa:28981.
UCSCi uc001tqg.3. human. [Q8WYA0-3 ]
uc001tqh.3. human. [Q8WYA0-1 ]

Organism-specific databases

CTDi 28981.
GeneCardsi GC12P110562.
HGNCi HGNC:14313. IFT81.
HPAi HPA019087.
HPA020051.
MIMi 605489. gene.
neXtProti NX_Q8WYA0.
PharmGKBi PA26349.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG77882.
GeneTreei ENSGT00390000000999.
HOGENOMi HOG000237323.
HOVERGENi HBG048817.
InParanoidi Q8WYA0.
OMAi YPVLHWL.
OrthoDBi EOG7JHM54.
PhylomeDBi Q8WYA0.
TreeFami TF314635.

Miscellaneous databases

ChiTaRSi IFT81. human.
GeneWikii IFT81.
GenomeRNAii 28981.
NextBioi 51867.
PROi Q8WYA0.
SOURCEi Search...

Gene expression databases

Bgeei Q8WYA0.
CleanExi HS_IFT81.
ExpressionAtlasi Q8WYA0. baseline and differential.
Genevestigatori Q8WYA0.

Family and domain databases

InterProi IPR029600. IFT81.
[Graphical view ]
PANTHERi PTHR15614. PTHR15614. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genomic organization and mapping of mouse CDV (carnitine deficiency-associated gene expressed in ventricle)-1 and its related CDV-1R gene."
    Higashi M., Kobayashi K., Iijima M., Wakana S., Horiuchi M., Yasuda T., Yoshida G., Kanmura Y., Saheki T.
    Mamm. Genome 11:1053-1057(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CDV-1R).
    Tissue: Lymphocyte.
  2. "Identification of human CDV-1R and mouse Cdv-1R, two novel proteins with putative signal peptides, especially highly expressed in testis and increased with the male sex maturation."
    Peng J., Yu L., Horiuchi M., Zhang P., Huang X., Zhang Y., Li D., Jalil M.A., Zhao S.
    Mol. Biol. Rep. 29:353-362(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CDV-1R), TISSUE SPECIFICITY.
    Tissue: Testis1 Publication.
  3. Hu G.
    Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CDV-1).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND CDV-1).
    Tissue: Skeletal muscleImported and UterusImported.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-676 (ISOFORM CDV-1R).
    Tissue: Fetal brain1 Publication.
  7. "Characterization of the intraflagellar transport complex B core: direct interaction of the IFT81 and IFT74/72 subunits."
    Lucker B.F., Behal R.H., Qin H., Siron L.C., Taggart W.D., Rosenbaum J.L., Cole D.G.
    J. Biol. Chem. 280:27688-27696(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH IFT74.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-61, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  11. "Molecular basis of tubulin transport within the cilium by IFT74 and IFT81."
    Bhogaraju S., Cajanek L., Fort C., Blisnick T., Weber K., Taschner M., Mizuno N., Lamla S., Bastin P., Nigg E.A., Lorentzen E.
    Science 341:1009-1012(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, IDENTIFICATION IN THE IFT COMPLEX B, INTERACTION WITH TUBULIN AND IFT74, MUTAGENESIS OF 73-LYS--LYS-75 AND 113-LYS-LYS-114.

Entry informationi

Entry nameiIFT81_HUMAN
AccessioniPrimary (citable) accession number: Q8WYA0
Secondary accession number(s): Q2YDY1
, Q8NB51, Q9BSV2, Q9UNY8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 1, 2002
Last modified: October 29, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3