Q8WYA0 (IFT81_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Intraflagellar transport protein 81 homolog Alternative name(s): Carnitine deficiency-associated protein expressed in ventricle 1 Short name=CDV-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 676 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform CDV-1 may be involved in cardiac hypertrophy caused by carnitine deficiency By similarity. UniProtKB O35594 Isoform CDV-1R appears to play a role in development of the testis and spermatogenesis By similarity. |
| Tissue specificity | Highly expressed in testis, moderately in ovary, heart, liver, skeletal muscle, kidney and pancreas, low in prostate, brain, placenta and lung and not detected in spleen, thymus, small intestine and colon. Isoform CDV-1R is abundantly expressed in testis. Ref.2 |
Ontologies
| Keywords | |
|---|---|
| Biological process | Differentiation Spermatogenesis |
| Coding sequence diversity | Alternative initiation Alternative splicing |
| Domain | Coiled coil |
| Molecular function | Developmental protein |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell differentiation Inferred from electronic annotation. Source: UniProtKB-KW multicellular organismal developmentInferred from electronic annotation. Source: UniProtKB-KW spermatogenesisInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | centrosome Inferred from electronic annotation. Source: Compara intraflagellar transport particle BInferred from sequence or structural similarity. Source: BHF-UCL motile ciliumInferred from sequence or structural similarity. Source: BHF-UCL |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] | ||||||
| Isoform CDV-1R Ref.1 Ref.2 (identifier: Q8WYA0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WYA0-3) The sequence of this isoform differs from the canonical sequence as follows: 397-431: FKRYVNKLRSKSTVFKKKHQIIAELKAEFGLLQRT → RQDLTLSPRLECGGVIMAYCSLKLLGSSDPPTSAS 432-676: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform CDV-1 (identifier: Q8WYA0-4) The sequence of this isoform differs from the canonical sequence as follows: 1-569: Missing. | ||||||
| Note: Produced by alternative initiation at Met-570 of isoform CDV-1R. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 676 | 676 | Intraflagellar transport protein 81 homolog UniProtKB O35594 | PRO_0000020916 | |||||
Regions | |||||||||
| Coiled coil | 132 – 258 | 127 | Potential | ||||||
| Coiled coil | 306 – 389 | 84 | Potential | ||||||
| Coiled coil | 416 – 456 | 41 | Potential | ||||||
| Coiled coil | 490 – 622 | 133 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 61 | 1 | Phosphothreonine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 569 | 569 | Missing in isoform CDV-1. | VSP_018784 | |||||
| Alternative sequence | 397 – 431 | 35 | FKRYV…LLQRT → RQDLTLSPRLECGGVIMAYC SLKLLGSSDPPTSAS in isoform 2. | VSP_050695 | |||||
| Alternative sequence | 432 – 676 | 245 | Missing in isoform 2. | VSP_050696 | |||||
Experimental info | |||||||||
| Sequence conflict | 59 | 1 | E → K in BAC03690. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic organization and mapping of mouse CDV (carnitine deficiency-associated gene expressed in ventricle)-1 and its related CDV-1R gene." Higashi M., Kobayashi K., Iijima M., Wakana S., Horiuchi M., Yasuda T., Yoshida G., Kanmura Y., Saheki T. Mamm. Genome 11:1053-1057(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CDV-1R). Tissue: Lymphocyte. |
| [2] | "Identification of human CDV-1R and mouse Cdv-1R, two novel proteins with putative signal peptides, especially highly expressed in testis and increased with the male sex maturation." Peng J., Yu L., Horiuchi M., Zhang P., Huang X., Zhang Y., Li D., Jalil M.A., Zhao S. Mol. Biol. Rep. 29:353-362(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CDV-1R), TISSUE SPECIFICITY. Tissue: Testis. |
| [3] | Hu G. Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CDV-1). |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND CDV-1). Tissue: Skeletal muscle and Uterus. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 32-676 (ISOFORM CDV-1R). Tissue: Fetal brain. |
| [7] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-61, MASS SPECTROMETRY. Tissue: Platelet. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF250326 mRNA. Translation: AAL50343.1. AF332010 mRNA. Translation: AAO32947.1. AF139540 mRNA. Translation: AAP97269.1. AF078932 mRNA. Translation: AAD48091.1. CH471054 Genomic DNA. Translation: EAW97898.1. BC004536 mRNA. Translation: AAH04536.2. BC029349 mRNA. Translation: AAH29349.1. BC108257 mRNA. Translation: AAI08258.1. AK091549 mRNA. Translation: BAC03690.1. Sequence problems. |
| IPI | IPI00027818. IPI00165189. IPI00759494. |
| RefSeq | NP_001137251.1. NM_001143779.1. NP_054774.2. NM_014055.3. NP_113661.2. NM_031473.3. |
| UniGene | Hs.528382. |
3D structure databases | |
| ProteinModelPortal | Q8WYA0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000242591. |
PTM databases | |
| PhosphoSite | Q8WYA0. |
Polymorphism databases | |
| DMDM | 48474907. |
Proteomic databases | |
| PaxDb | Q8WYA0. |
| PRIDE | Q8WYA0. |
Protocols and materials databases | |
| DNASU | 28981. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000242591; ENSP00000242591; ENSG00000122970. ENST00000361948; ENSP00000355372; ENSG00000122970. ENST00000550748; ENSP00000446868; ENSG00000122970. ENST00000552912; ENSP00000449718; ENSG00000122970. |
| GeneID | 28981. |
| KEGG | hsa:28981. |
| UCSC | uc001tqg.3. human. uc001tqh.3. human. |
Organism-specific databases | |
| CTD | 28981. |
| GeneCards | GC12P110562. |
| HGNC | HGNC:14313. IFT81. |
| HPA | HPA019087. HPA020051. |
| MIM | 605489. gene. |
| neXtProt | NX_Q8WYA0. |
| PharmGKB | PA26349. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG77882. |
| HOGENOM | HOG000237323. |
| HOVERGEN | HBG048817. |
| InParanoid | Q8WYA0. |
| OMA | QKVVSEP. |
| OrthoDB | EOG4KSPJ8. |
Gene expression databases | |
| ArrayExpress | Q8WYA0. |
| Bgee | Q8WYA0. |
| CleanEx | HS_IFT81. |
| Genevestigator | Q8WYA0. |
| GermOnline | ENSG00000122970. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | IFT81. human. |
| GenomeRNAi | 28981. |
| NextBio | 51867. |
| SOURCE | Search... |
Entry information
| Entry name | IFT81_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WYA0 Secondary accession number(s): Q2YDY1 Q9UNY8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
