Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

VPS10 domain-containing receptor SorCS1

Gene

SORCS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • neuropeptide receptor activity Source: UniProtKB

GO - Biological processi

  • neuropeptide signaling pathway Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
VPS10 domain-containing receptor SorCS1
Short name:
hSorCS
Gene namesi
Name:SORCS1
Synonyms:SORCS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:16697. SORCS1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini34 – 10991066LumenalSequence analysisAdd
BLAST
Transmembranei1100 – 112021HelicalSequence analysisAdd
BLAST
Topological domaini1121 – 116848CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134861284.

Polymorphism and mutation databases

BioMutaiSORCS1.
DMDMi66774216.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3333Sequence analysisAdd
BLAST
Chaini34 – 11681135VPS10 domain-containing receptor SorCS1PRO_0000033170Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi68 – 681O-linked (GalNAc...)1 Publication
Glycosylationi184 – 1841N-linked (GlcNAc...)Sequence analysis
Glycosylationi352 – 3521N-linked (GlcNAc...)Sequence analysis
Glycosylationi433 – 4331N-linked (GlcNAc...)Sequence analysis
Glycosylationi765 – 7651N-linked (GlcNAc...)Sequence analysis
Glycosylationi776 – 7761N-linked (GlcNAc...)Sequence analysis
Glycosylationi816 – 8161N-linked (GlcNAc...)Sequence analysis
Glycosylationi847 – 8471N-linked (GlcNAc...)Sequence analysis
Glycosylationi908 – 9081N-linked (GlcNAc...)Sequence analysis
Glycosylationi929 – 9291N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

O-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ8WY21.
PRIDEiQ8WY21.
TopDownProteomicsiQ8WY21-3. [Q8WY21-3]

PTM databases

iPTMnetiQ8WY21.
PhosphoSiteiQ8WY21.

Expressioni

Tissue specificityi

Detected in fetal and infant brain and in fetal retina.

Gene expression databases

BgeeiQ8WY21.
ExpressionAtlasiQ8WY21. baseline and differential.
GenevisibleiQ8WY21. HS.

Organism-specific databases

HPAiHPA011948.

Interactioni

Protein-protein interaction databases

BioGridi125367. 1 interaction.
STRINGi9606.ENSP00000345964.

Structurei

3D structure databases

ProteinModelPortaliQ8WY21.
SMRiQ8WY21. Positions 159-781, 791-889.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati208 – 21912BNR 1Add
BLAST
Repeati256 – 26712BNR 2Add
BLAST
Repeati492 – 50312BNR 3Add
BLAST
Repeati569 – 58012BNR 4Add
BLAST
Repeati611 – 62212BNR 5Add
BLAST
Domaini803 – 89492PKDPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 5 BNR repeats.Curated
Contains 1 PKD domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410ISX7. Eukaryota.
ENOG410Z4SB. LUCA.
GeneTreeiENSGT00510000046443.
HOVERGENiHBG059252.
InParanoidiQ8WY21.
OMAiIKHVYHN.
OrthoDBiEOG7GJ6C3.
PhylomeDBiQ8WY21.
TreeFamiTF324918.

Family and domain databases

Gene3Di2.60.40.670. 1 hit.
InterProiIPR000601. PKD_dom.
IPR031777. Sortilin_C.
IPR031778. Sortilin_N.
IPR006581. VPS10.
[Graphical view]
PfamiPF00801. PKD. 1 hit.
PF15902. Sortilin-Vps10. 1 hit.
PF15901. Sortilin_C. 1 hit.
[Graphical view]
SMARTiSM00602. VPS10. 1 hit.
[Graphical view]
SUPFAMiSSF49299. SSF49299. 2 hits.
PROSITEiPS50093. PKD. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WY21-1) [UniParc]FASTAAdd to basket

Also known as: B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGKVGAGGGS QARLSALLAG AGLLILCAPG VCGGGSCCPS PHPSSAPRSA
60 70 80 90 100
STPRGFSHQG RPGRAPATPL PLVVRPLFSV APGDRALSLE RARGTGASMA
110 120 130 140 150
VAARSGRRRR SGADQEKAER GEGASRSPRG VLRDGGQQEP GTRERDPDKA
160 170 180 190 200
TRFRMEELRL TSTTFALTGD SAHNQAMVHW SGHNSSVILI LTKLYDYNLG
210 220 230 240 250
SITESSLWRS TDYGTTYEKL NDKVGLKTIL SYLYVCPTNK RKIMLLTDPE
260 270 280 290 300
IESSLLISSD EGATYQKYRL NFYIQSLLFH PKQEDWILAY SQDQKLYSSA
310 320 330 340 350
EFGRRWQLIQ EGVVPNRFYW SVMGSNKEPD LVHLEARTVD GHSHYLTCRM
360 370 380 390 400
QNCTEANRNQ PFPGYIDPDS LIVQDHYVFV QLTSGGRPHY YVSYRRNAFA
410 420 430 440 450
QMKLPKYALP KDMHVISTDE NQVFAAVQEW NQNDTYNLYI SDTRGVYFTL
460 470 480 490 500
ALENVQSSRG PEGNIMIDLY EVAGIKGMFL ANKKIDNQVK TFITYNKGRD
510 520 530 540 550
WRLLQAPDTD LRGDPVHCLL PYCSLHLHLK VSENPYTSGI IASKDTAPSI
560 570 580 590 600
IVASGNIGSE LSDTDISMFV SSDAGNTWRQ IFEEEHSVLY LDQGGVLVAM
610 620 630 640 650
KHTSLPIRHL WLSFDEGRSW SKYSFTSIPL FVDGVLGEPG EETLIMTVFG
660 670 680 690 700
HFSHRSEWQL VKVDYKSIFD RRCAEEDYRP WQLHSQGEAC IMGAKRIYKK
710 720 730 740 750
RKSERKCMQG KYAGAMESEP CVCTEADFDC DYGYERHSNG QCLPAFWFNP
760 770 780 790 800
SSLSKDCSLG QSYLNSTGYR KVVSNNCTDG VREQYTAKPQ KCPGKAPRGL
810 820 830 840 850
RIVTADGKLT AEQGHNVTLM VQLEEGDVQR TLIQVDFGDG IAVSYVNLSS
860 870 880 890 900
MEDGIKHVYQ NVGIFRVTVQ VDNSLGSDSA VLYLHVTCPL EHVHLSLPFV
910 920 930 940 950
TTKNKEVNAT AVLWPSQVGT LTYVWWYGNN TEPLITLEGS ISFRFTSEGM
960 970 980 990 1000
NTITVQVSAG NAILQDTKTI AVYEEFRSLR LSFSPNLDDY NPDIPEWRRD
1010 1020 1030 1040 1050
IGRVIKKSLV EATGVPGQHI LVAVLPGLPT TAELFVLPYQ DPAGENKRST
1060 1070 1080 1090 1100
DDLEQISELL IHTLNQNSVH FELKPGVRVL VHAAHLTAAP LVDLTPTHSG
1110 1120 1130 1140 1150
SAMLMLLSVV FVGLAVFVIY KFKRRVALPS PPSPSTQPGD SSLRLQRARH
1160
ATPPSTPKRG SAGAQYAI
Length:1,168
Mass (Da):129,635
Last modified:May 24, 2005 - v3
Checksum:iBAF8D4FB87A4F998
GO
Isoform 2 (identifier: Q8WY21-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1125-1168: RVALPSPPSP...RGSAGAQYAI → KIPGINVYAQ...TKEIPTYVNV

Note: Gene prediction based on EST data.
Show »
Length:1,198
Mass (Da):133,373
Checksum:i1B7EE3F03DC9CDE0
GO
Isoform 3 (identifier: Q8WY21-3) [UniParc]FASTAAdd to basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1125-1168: RVALPSPPSP...RGSAGAQYAI → KIPGINVYAQ...EKVESQLIGK

Show »
Length:1,179
Mass (Da):131,327
Checksum:i0C2E5DACD6A47209
GO
Isoform 4 (identifier: Q8WY21-4) [UniParc]FASTAAdd to basket

Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1125-1168: RVALPSPPSP...RGSAGAQYAI → CVSLYPRSPTPDLFLLPDRFRSMCYSDVHSSDGFY

Note: No experimental confirmation available.
Show »
Length:1,159
Mass (Da):129,141
Checksum:i46135ADD8F627AAE
GO

Sequence cautioni

The sequence BAD92379.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAI40754.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI40755.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti231 – 2311S → G in AAL56667 (PubMed:12482870).Curated
Sequence conflicti487 – 4871N → Y in AAL56667 (PubMed:12482870).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti223 – 2231K → N in a breast cancer sample; somatic mutation. 1 Publication
VAR_036374

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1125 – 116844RVALP…AQYAI → KIPGINVYAQMQNEKEQEMI SPVSHSESRPNVPQTELRRP GQLIDEKVESQLIGSISIVA ENQSTKEIPTYVNV in isoform 2. CuratedVSP_006204Add
BLAST
Alternative sequencei1125 – 116844RVALP…AQYAI → KIPGINVYAQMQNEKEQEMI SPVSHSESRPNVPQTELRRP GQLIDEKVESQLIGK in isoform 3. 1 PublicationVSP_015140Add
BLAST
Alternative sequencei1125 – 116844RVALP…AQYAI → CVSLYPRSPTPDLFLLPDRF RSMCYSDVHSSDGFY in isoform 4. 1 PublicationVSP_015141Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF284756 mRNA. Translation: AAL56667.1.
AY099452 mRNA. Translation: AAM43811.1.
AY099453 mRNA. Translation: AAM43812.1.
AB209142 mRNA. Translation: BAD92379.1. Different initiation.
AL160010
, AL133395, AL356255, AL356308, AL357333 Genomic DNA. Translation: CAH70582.1.
AL356255
, AL133395, AL160010, AL356308, AL357333 Genomic DNA. Translation: CAH73442.1.
AL356308
, AL133395, AL160010, AL356255, AL357333 Genomic DNA. Translation: CAI14367.1.
AL357333
, AL133395, AL160010, AL356255, AL356308 Genomic DNA. Translation: CAI16407.1.
AL133395
, AL160010, AL356255, AL356308, AL357333 Genomic DNA. Translation: CAI40753.1.
AL133395 Genomic DNA. Translation: CAI40754.1. Sequence problems.
AL133395 Genomic DNA. Translation: CAI40755.1. Sequence problems.
CH471066 Genomic DNA. Translation: EAW49583.1.
BC131597 mRNA. Translation: AAI31598.1.
CCDSiCCDS7559.1. [Q8WY21-1]
RefSeqiNP_001013049.1. NM_001013031.2. [Q8WY21-2]
NP_001193498.1. NM_001206569.1. [Q8WY21-3]
NP_001193499.1. NM_001206570.1.
NP_001193500.1. NM_001206571.1. [Q8WY21-4]
NP_001193501.1. NM_001206572.1.
NP_443150.3. NM_052918.4. [Q8WY21-1]
UniGeneiHs.591915.

Genome annotation databases

EnsembliENST00000263054; ENSP00000263054; ENSG00000108018. [Q8WY21-1]
GeneIDi114815.
KEGGihsa:114815.
UCSCiuc001kym.4. human. [Q8WY21-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF284756 mRNA. Translation: AAL56667.1.
AY099452 mRNA. Translation: AAM43811.1.
AY099453 mRNA. Translation: AAM43812.1.
AB209142 mRNA. Translation: BAD92379.1. Different initiation.
AL160010
, AL133395, AL356255, AL356308, AL357333 Genomic DNA. Translation: CAH70582.1.
AL356255
, AL133395, AL160010, AL356308, AL357333 Genomic DNA. Translation: CAH73442.1.
AL356308
, AL133395, AL160010, AL356255, AL357333 Genomic DNA. Translation: CAI14367.1.
AL357333
, AL133395, AL160010, AL356255, AL356308 Genomic DNA. Translation: CAI16407.1.
AL133395
, AL160010, AL356255, AL356308, AL357333 Genomic DNA. Translation: CAI40753.1.
AL133395 Genomic DNA. Translation: CAI40754.1. Sequence problems.
AL133395 Genomic DNA. Translation: CAI40755.1. Sequence problems.
CH471066 Genomic DNA. Translation: EAW49583.1.
BC131597 mRNA. Translation: AAI31598.1.
CCDSiCCDS7559.1. [Q8WY21-1]
RefSeqiNP_001013049.1. NM_001013031.2. [Q8WY21-2]
NP_001193498.1. NM_001206569.1. [Q8WY21-3]
NP_001193499.1. NM_001206570.1.
NP_001193500.1. NM_001206571.1. [Q8WY21-4]
NP_001193501.1. NM_001206572.1.
NP_443150.3. NM_052918.4. [Q8WY21-1]
UniGeneiHs.591915.

3D structure databases

ProteinModelPortaliQ8WY21.
SMRiQ8WY21. Positions 159-781, 791-889.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125367. 1 interaction.
STRINGi9606.ENSP00000345964.

PTM databases

iPTMnetiQ8WY21.
PhosphoSiteiQ8WY21.

Polymorphism and mutation databases

BioMutaiSORCS1.
DMDMi66774216.

Proteomic databases

PaxDbiQ8WY21.
PRIDEiQ8WY21.
TopDownProteomicsiQ8WY21-3. [Q8WY21-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263054; ENSP00000263054; ENSG00000108018. [Q8WY21-1]
GeneIDi114815.
KEGGihsa:114815.
UCSCiuc001kym.4. human. [Q8WY21-1]

Organism-specific databases

CTDi114815.
GeneCardsiSORCS1.
HGNCiHGNC:16697. SORCS1.
HPAiHPA011948.
MIMi606283. gene.
neXtProtiNX_Q8WY21.
PharmGKBiPA134861284.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ISX7. Eukaryota.
ENOG410Z4SB. LUCA.
GeneTreeiENSGT00510000046443.
HOVERGENiHBG059252.
InParanoidiQ8WY21.
OMAiIKHVYHN.
OrthoDBiEOG7GJ6C3.
PhylomeDBiQ8WY21.
TreeFamiTF324918.

Miscellaneous databases

GenomeRNAii114815.
NextBioi79273.
PROiQ8WY21.
SOURCEiSearch...

Gene expression databases

BgeeiQ8WY21.
ExpressionAtlasiQ8WY21. baseline and differential.
GenevisibleiQ8WY21. HS.

Family and domain databases

Gene3Di2.60.40.670. 1 hit.
InterProiIPR000601. PKD_dom.
IPR031777. Sortilin_C.
IPR031778. Sortilin_N.
IPR006581. VPS10.
[Graphical view]
PfamiPF00801. PKD. 1 hit.
PF15902. Sortilin-Vps10. 1 hit.
PF15901. Sortilin_C. 1 hit.
[Graphical view]
SMARTiSM00602. VPS10. 1 hit.
[Graphical view]
SUPFAMiSSF49299. SSF49299. 2 hits.
PROSITEiPS50093. PKD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of sorCS1, an alternatively spliced receptor with completely different cytoplasmic domains that mediate different trafficking in cells."
    Hermey G., Keat S.J., Madsen P., Jacobsen C., Petersen C.M., Gliemann J.
    J. Biol. Chem. 278:7390-7396(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4).
  2. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "The genes for the human VPS10 domain-containing receptors are large and contain many small exons."
    Hampe W., Rezgaoui M., Hermans-Borgmeyer I., Schaller H.C.
    Hum. Genet. 108:529-536(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  7. "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins."
    Halim A., Ruetschi U., Larson G., Nilsson J.
    J. Proteome Res. 12:573-584(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT THR-68, IDENTIFICATION BY MASS SPECTROMETRY.
  8. Cited for: VARIANT [LARGE SCALE ANALYSIS] ASN-223.

Entry informationi

Entry nameiSORC1_HUMAN
AccessioniPrimary (citable) accession number: Q8WY21
Secondary accession number(s): A2RRF4
, Q59GG7, Q5JVT7, Q5JVT8, Q5VY14, Q86WQ1, Q86WQ2, Q9H1Y1, Q9H1Y2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 13, 2002
Last sequence update: May 24, 2005
Last modified: May 11, 2016
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.