SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WXR4

- MYO3B_HUMAN

UniProt

Q8WXR4 - MYO3B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Myosin-IIIb
Gene
MYO3B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Probable actin-based motor with a protein kinase activity.

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei56 – 561ATP By similarity
Active sitei156 – 1561Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi33 – 419ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. microfilament motor activity Source: Ensembl
  3. protein serine/threonine kinase activity Source: UniProtKB-KW

GO - Biological processi

  1. peptidyl-serine phosphorylation Source: Ensembl
  2. peptidyl-threonine phosphorylation Source: Ensembl
  3. positive regulation of filopodium assembly Source: Ensembl
  4. protein autophosphorylation Source: Ensembl
  5. response to stimulus Source: UniProtKB-KW
  6. visual perception Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Motor protein, Myosin, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Sensory transduction, Vision

Keywords - Ligandi

Actin-binding, ATP-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLinkiQ8WXR4.

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin-IIIb (EC:2.7.11.1)
Gene namesi
Name:MYO3B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:15576. MYO3B.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. filopodium tip Source: Ensembl
  3. myosin complex Source: UniProtKB-KW
  4. photoreceptor inner segment Source: Ensembl
  5. photoreceptor outer segment Source: Ensembl
  6. stereocilium bundle tip Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31406.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13411341Myosin-IIIb
PRO_0000086415Add
BLAST

Proteomic databases

PaxDbiQ8WXR4.
PRIDEiQ8WXR4.

PTM databases

PhosphoSiteiQ8WXR4.

Expressioni

Tissue specificityi

Expressed in retina, kidney and testis.

Gene expression databases

ArrayExpressiQ8WXR4.
BgeeiQ8WXR4.
GenevestigatoriQ8WXR4.

Interactioni

Protein-protein interaction databases

BioGridi126621. 4 interactions.
IntActiQ8WXR4. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8WXR4.
SMRiQ8WXR4. Positions 15-327, 347-1046, 1073-1129.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini27 – 293267Protein kinase
Add
BLAST
Domaini343 – 1058716Myosin motor
Add
BLAST
Domaini1060 – 108930IQ 1
Add
BLAST
Domaini1087 – 111630IQ 2
Add
BLAST

Sequence similaritiesi

In the C-terminal section; belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family.
In the N-terminal section; belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family.
Contains 2 IQ domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG0515.
HOVERGENiHBG052555.
InParanoidiQ8WXR4.
KOiK08834.
OMAiHWVLGKT.
OrthoDBiEOG7SJD3P.
PhylomeDBiQ8WXR4.
TreeFamiTF326512.

Family and domain databases

InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR011009. Kinase-like_dom.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00612. IQ. 1 hit.
PF00063. Myosin_head. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00015. IQ. 2 hits.
SM00242. MYSc. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50096. IQ. 2 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WXR4-1) [UniParc]FASTAAdd to Basket

Also known as: MYO3B.2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKHLYGLFHY NPMMLGLESL PDPTDTWEII ETIGKGTYGK VYKVTNKRDG     50
SLAAVKILDP VSDMDEEIEA EYNILQFLPN HPNVVKFYGM FYKADHCVGG 100
QLWLVLELCN GGSVTELVKG LLRCGQRLDE AMISYILYGA LLGLQHLHNN 150
RIIHRDVKGN NILLTTEGGV KLVDFGVSAQ LTSTRLRRNT SVGTPFWMAP 200
EVIACEQQYD SSYDARCDVW SLGITAIELG DGDPPLFDMH PVKTLFKIPR 250
NPPPTLLHPE KWCEEFNHFI SQCLIKDFER RPSVTHLLDH PFIKGVHGKV 300
LFLQKQLAKV LQDQKHQNPV AKTRHERMHT RRPYHVEDAE KYCLEDDLVN 350
LEVLDEDTII HQLQKRYADL LIYTYVGDIL IALNPFQNLS IYSPQFSRLY 400
HGVKRASNPP HIFASADAAY QCMVTLSKDQ CIVISGESGS GKTESAHLIV 450
QHLTFLGKAN NQTLREKILQ VNSLVEAFGN SCTAINDNSS RFGKYLEMMF 500
TPTGVVMGAR ISEYLLEKSR VIKQAAREKN FHIFYYIYAG LHHQKKLSDF 550
RLPEEKPPRY IADETGRVMH DITSKESYRR QFEAIQHCFR IIGFTDKEVH 600
SVYRILAGIL NIGNIEFAAI SSQHQTDKSE VPNAEALQNA ASVLCISPEE 650
LQEALTSHCV VTRGETIIRA NTVDRAADVR DAMSKALYGR LFSWIVNRIN 700
TLLQPDENIC SAGGGMNVGI LDIFGFENFQ RNSFEQLCIN IANEQIQYYF 750
NQHVFALEQM EYQNEGIDAV PVEYEDNRPL LDMFLQKPLG LLALLDEESR 800
FPQATDQTLV DKFEDNLRCK YFWRPKGVEL CFGIQHYAGK VLYDASGVLE 850
KNRDTLPADV VVVLRTSENK LLQQLFSIPL TKTGNLAQTR ARITVASSSL 900
PPHFSAGKAK VDTLEVIRHP EETTNMKRQT VASYFRYSLM DLLSKMVVGQ 950
PHFVRCIKPN DDREALQFSR ERVLAQLRST GILETVSIRR QGYSHRILFE 1000
EFVKRYYYLA FTAHQTPLAS KESCVAILEK SRLDHWVLGK TKVFLKYYHV 1050
EQLNLLLREV IGRVVVLQAY TKGWLGARRY KRVREKREKG AIAIQSAWRG 1100
YDARRKFKKI SNRRNESAAH NQAGDTSNQS SGPHSPVAAG TRGSAEVQDC 1150
SEPGDHKVLR GSVHRRSHSQ AESNNGRTQT SSNSPAVTEK NGHSQAQSSP 1200
KGCDIFAGHA NKHSVSGTDL LSSRICHPAP DQQGLSLWGA PQKPGSENGL 1250
AQKHRTPRRR CQQPKMLSSP EDTMYYNQLN GTLEYQGSKR KPRKLGQIKV 1300
LDGEDEYYKS LSPVDCIPEE NNSAHPSFFS SSSKGDSFAQ H 1341
Length:1,341
Mass (Da):151,829
Last modified:May 18, 2010 - v4
Checksum:i76F84C571DAA269D
GO
Isoform 2 (identifier: Q8WXR4-2) [UniParc]FASTAAdd to Basket

Also known as: MYO3B.0

The sequence of this isoform differs from the canonical sequence as follows:
     1245-1341: GSENGLAQKH...SSKGDSFAQH → AFPHYGCNFYGFRKWSCTEASNTSPTMSAAQNAE

Show »
Length:1,278
Mass (Da):144,595
Checksum:i08890776C830E4A2
GO
Isoform 3 (identifier: Q8WXR4-3) [UniParc]FASTAAdd to Basket

Also known as: MYO3B.1

The sequence of this isoform differs from the canonical sequence as follows:
     1097-1123: Missing.
     1245-1341: GSENGLAQKH...SSKGDSFAQH → AFPHYGCNFYGFRKWSCTEASNTSPTMSAAQNAE

Show »
Length:1,251
Mass (Da):141,381
Checksum:i361E5B30B7EC31A9
GO
Isoform 4 (identifier: Q8WXR4-4) [UniParc]FASTAAdd to Basket

Also known as: MYO3B.3

The sequence of this isoform differs from the canonical sequence as follows:
     1097-1123: Missing.

Show »
Length:1,314
Mass (Da):148,615
Checksum:iF3A4479775B9C11B
GO
Isoform 5 (identifier: Q8WXR4-5) [UniParc]FASTAAdd to Basket

Also known as: MYO3B.4

The sequence of this isoform differs from the canonical sequence as follows:
     1193-1341: HSQAQSSPKG...SSKGDSFAQH → WSFTLLLRLE...YAILLQISKD

Show »
Length:1,275
Mass (Da):144,329
Checksum:i5FA002DEC199A3B1
GO
Isoform 6 (identifier: Q8WXR4-6) [UniParc]FASTAAdd to Basket

Also known as: MYO3B.5

The sequence of this isoform differs from the canonical sequence as follows:
     1193-1341: Missing.

Show »
Length:1,192
Mass (Da):135,407
Checksum:i28488BBC7CD00706
GO
Isoform 7 (identifier: Q8WXR4-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLQSALLSTR

Note: No experimental confirmation available.

Show »
Length:1,350
Mass (Da):152,799
Checksum:i4DFD8DBA81A82CBE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211P → S.1 Publication
Corresponds to variant rs35391761 [ dbSNP | Ensembl ].
VAR_040886
Natural varianti185 – 1851R → H.1 Publication
Corresponds to variant rs55911154 [ dbSNP | Ensembl ].
VAR_040887
Natural varianti267 – 2671N → S.1 Publication
Corresponds to variant rs34509373 [ dbSNP | Ensembl ].
VAR_040888
Natural varianti275 – 2751I → V.1 Publication
Corresponds to variant rs10209102 [ dbSNP | Ensembl ].
VAR_030605
Natural varianti309 – 3091K → E.2 Publications
Corresponds to variant rs4668246 [ dbSNP | Ensembl ].
VAR_030606
Natural varianti316 – 3161H → L.1 Publication
Corresponds to variant rs55633190 [ dbSNP | Ensembl ].
VAR_040889
Natural varianti352 – 3521E → Q.1 Publication
Corresponds to variant rs56179904 [ dbSNP | Ensembl ].
VAR_040890
Natural varianti388 – 3881N → S.1 Publication
Corresponds to variant rs34273653 [ dbSNP | Ensembl ].
VAR_040891
Natural varianti406 – 4061A → T.1 Publication
Corresponds to variant rs10168181 [ dbSNP | Ensembl ].
VAR_030607
Natural varianti638 – 6381Q → P.1 Publication
Corresponds to variant rs55911627 [ dbSNP | Ensembl ].
VAR_040892
Natural varianti770 – 7701V → I.2 Publications
Corresponds to variant rs6736609 [ dbSNP | Ensembl ].
VAR_030608
Natural varianti773 – 7731E → G.2 Publications
Corresponds to variant rs33962844 [ dbSNP | Ensembl ].
VAR_040893
Natural varianti798 – 7981E → K.
Corresponds to variant rs11892763 [ dbSNP | Ensembl ].
VAR_030609
Natural varianti918 – 9181R → Q.1 Publication
Corresponds to variant rs55769829 [ dbSNP | Ensembl ].
VAR_040894
Natural varianti969 – 9691S → C.1 Publication
Corresponds to variant rs35857918 [ dbSNP | Ensembl ].
VAR_040895
Natural varianti990 – 9901R → C.1 Publication
Corresponds to variant rs34236931 [ dbSNP | Ensembl ].
VAR_040896
Natural varianti1082 – 10821R → K.2 Publications
Corresponds to variant rs10185178 [ dbSNP | Ensembl ].
VAR_030610
Natural varianti1092 – 10921I → V.1 Publication
Corresponds to variant rs34219776 [ dbSNP | Ensembl ].
VAR_040897
Natural varianti1137 – 11371V → I.1 Publication
Corresponds to variant rs34546065 [ dbSNP | Ensembl ].
VAR_040898
Natural varianti1165 – 11651R → C.1 Publication
Corresponds to variant rs56052422 [ dbSNP | Ensembl ].
VAR_040899

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLQSALLSTR in isoform 7.
VSP_023111
Alternative sequencei1097 – 112327Missing in isoform 3 and isoform 4.
VSP_010162Add
BLAST
Alternative sequencei1193 – 1341149HSQAQ…SFAQH → WSFTLLLRLECNSMISADCN LRPLGSSDSPASASRVAGIT GIHKPRVLQKGAISSQDMQT STRFLGLICCLLGYAILLQI SKD in isoform 5.
VSP_010164Add
BLAST
Alternative sequencei1193 – 1341149Missing in isoform 6.
VSP_010165Add
BLAST
Alternative sequencei1245 – 134197GSENG…SFAQH → AFPHYGCNFYGFRKWSCTEA SNTSPTMSAAQNAE in isoform 2 and isoform 3.
VSP_010163Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti261 – 2611K → R in BAB71011. 1 Publication
Sequence conflicti573 – 5731T → A in BAB71011. 1 Publication
Sequence conflicti870 – 8701K → M in AAL57233. 1 Publication
Sequence conflicti870 – 8701K → M in AAO13799. 1 Publication
Sequence conflicti870 – 8701K → M in AAO13800. 1 Publication
Sequence conflicti870 – 8701K → M in AAO13801. 1 Publication
Sequence conflicti870 – 8701K → M in AAO13802. 1 Publication
Sequence conflicti870 – 8701K → M in AAO13803. 1 Publication
Sequence conflicti1081 – 10811K → N in BAB71011. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF369908 mRNA. Translation: AAL57233.1.
AF391554 mRNA. Translation: AAO13799.1.
AF391555 mRNA. Translation: AAO13800.1.
AF391556 mRNA. Translation: AAO13801.1.
AF391557 mRNA. Translation: AAO13802.1.
AF391558 mRNA. Translation: AAO13803.1.
AC007277 Genomic DNA. No translation available.
AC012594 Genomic DNA. Translation: AAY24324.1.
AC068280 Genomic DNA. No translation available.
AC093402 Genomic DNA. No translation available.
AC114794 Genomic DNA. Translation: AAY24159.1.
AK055778 mRNA. Translation: BAB71011.1.
CCDSiCCDS42773.1. [Q8WXR4-1]
CCDS46446.1. [Q8WXR4-4]
RefSeqiNP_001077084.2. NM_001083615.3. [Q8WXR4-4]
NP_620482.3. NM_138995.4. [Q8WXR4-1]
XP_006712362.1. XM_006712299.1. [Q8WXR4-7]
UniGeneiHs.671900.

Genome annotation databases

EnsembliENST00000317935; ENSP00000314650; ENSG00000071909. [Q8WXR4-3]
ENST00000334231; ENSP00000335100; ENSG00000071909. [Q8WXR4-7]
ENST00000408978; ENSP00000386213; ENSG00000071909. [Q8WXR4-1]
ENST00000409044; ENSP00000386497; ENSG00000071909. [Q8WXR4-4]
GeneIDi140469.
KEGGihsa:140469.
UCSCiuc002ufv.4. human. [Q8WXR4-1]
uc002ufz.3. human. [Q8WXR4-4]

Polymorphism databases

DMDMi296439486.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF369908 mRNA. Translation: AAL57233.1 .
AF391554 mRNA. Translation: AAO13799.1 .
AF391555 mRNA. Translation: AAO13800.1 .
AF391556 mRNA. Translation: AAO13801.1 .
AF391557 mRNA. Translation: AAO13802.1 .
AF391558 mRNA. Translation: AAO13803.1 .
AC007277 Genomic DNA. No translation available.
AC012594 Genomic DNA. Translation: AAY24324.1 .
AC068280 Genomic DNA. No translation available.
AC093402 Genomic DNA. No translation available.
AC114794 Genomic DNA. Translation: AAY24159.1 .
AK055778 mRNA. Translation: BAB71011.1 .
CCDSi CCDS42773.1. [Q8WXR4-1 ]
CCDS46446.1. [Q8WXR4-4 ]
RefSeqi NP_001077084.2. NM_001083615.3. [Q8WXR4-4 ]
NP_620482.3. NM_138995.4. [Q8WXR4-1 ]
XP_006712362.1. XM_006712299.1. [Q8WXR4-7 ]
UniGenei Hs.671900.

3D structure databases

ProteinModelPortali Q8WXR4.
SMRi Q8WXR4. Positions 15-327, 347-1046, 1073-1129.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 126621. 4 interactions.
IntActi Q8WXR4. 4 interactions.

Chemistry

ChEMBLi CHEMBL5654.
GuidetoPHARMACOLOGYi 2113.

PTM databases

PhosphoSitei Q8WXR4.

Polymorphism databases

DMDMi 296439486.

Proteomic databases

PaxDbi Q8WXR4.
PRIDEi Q8WXR4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317935 ; ENSP00000314650 ; ENSG00000071909 . [Q8WXR4-3 ]
ENST00000334231 ; ENSP00000335100 ; ENSG00000071909 . [Q8WXR4-7 ]
ENST00000408978 ; ENSP00000386213 ; ENSG00000071909 . [Q8WXR4-1 ]
ENST00000409044 ; ENSP00000386497 ; ENSG00000071909 . [Q8WXR4-4 ]
GeneIDi 140469.
KEGGi hsa:140469.
UCSCi uc002ufv.4. human. [Q8WXR4-1 ]
uc002ufz.3. human. [Q8WXR4-4 ]

Organism-specific databases

CTDi 140469.
GeneCardsi GC02P170998.
H-InvDB HIX0002580.
HGNCi HGNC:15576. MYO3B.
MIMi 610040. gene.
neXtProti NX_Q8WXR4.
PharmGKBi PA31406.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOVERGENi HBG052555.
InParanoidi Q8WXR4.
KOi K08834.
OMAi HWVLGKT.
OrthoDBi EOG7SJD3P.
PhylomeDBi Q8WXR4.
TreeFami TF326512.

Enzyme and pathway databases

SignaLinki Q8WXR4.

Miscellaneous databases

GenomeRNAii 140469.
NextBioi 84146.
PROi Q8WXR4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8WXR4.
Bgeei Q8WXR4.
Genevestigatori Q8WXR4.

Family and domain databases

InterProi IPR000048. IQ_motif_EF-hand-BS.
IPR011009. Kinase-like_dom.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00612. IQ. 1 hit.
PF00063. Myosin_head. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view ]
PRINTSi PR00193. MYOSINHEAVY.
SMARTi SM00015. IQ. 2 hits.
SM00242. MYSc. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEi PS50096. IQ. 2 hits.
PS51456. MYOSIN_MOTOR. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A class III myosin expressed in the retina is a potential candidate for Bardet-Biedl syndrome."
    Dose A.C., Burnside B.
    Genomics 79:621-624(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6), ALTERNATIVE SPLICING, VARIANT LYS-1082.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1104 (ISOFORM 7), VARIANTS GLU-309; ILE-770; GLY-773 AND LYS-1082.
    Tissue: Kidney.
  4. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-21; HIS-185; SER-267; VAL-275; GLU-309; LEU-316; GLN-352; SER-388; THR-406; PRO-638; ILE-770; GLY-773; GLN-918; CYS-969; CYS-990; VAL-1092; ILE-1137 AND CYS-1165.

Entry informationi

Entry nameiMYO3B_HUMAN
AccessioniPrimary (citable) accession number: Q8WXR4
Secondary accession number(s): B8ZZR2
, Q53QE1, Q53T08, Q8IX64, Q8IX65, Q8IX66, Q8IX67, Q8IX68, Q96N94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: May 18, 2010
Last modified: July 9, 2014
This is version 118 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi