Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8WXR4 (MYO3B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Myosin-IIIb

EC=2.7.11.1
Gene names
Name:MYO3B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1341 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Probable actin-based motor with a protein kinase activity.

Catalytic activity

ATP + a protein = ADP + a phosphoprotein.

Subcellular location

Cytoplasmcytoskeleton.

Tissue specificity

Expressed in retina, kidney and testis.

Sequence similarities

In the N-terminal section; belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family.

Contains 2 IQ domains.

Contains 1 myosin head-like domain.

Contains 1 protein kinase domain.

Ontologies

Keywords
   Biological processSensory transduction
Vision
   Cellular componentCytoplasm
Cytoskeleton
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
   LigandActin-binding
ATP-binding
Nucleotide-binding
   Molecular functionKinase
Motor protein
Myosin
Serine/threonine-protein kinase
Transferase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processpeptidyl-serine phosphorylation

Inferred from electronic annotation. Source: Ensembl

peptidyl-threonine phosphorylation

Inferred from electronic annotation. Source: Ensembl

positive regulation of filopodium assembly

Inferred from electronic annotation. Source: Ensembl

protein autophosphorylation

Inferred from electronic annotation. Source: Ensembl

response to stimulus

Inferred from electronic annotation. Source: UniProtKB-KW

visual perception

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-KW

filopodium tip

Inferred from electronic annotation. Source: Ensembl

myosin complex

Inferred from electronic annotation. Source: UniProtKB-KW

photoreceptor inner segment

Inferred from electronic annotation. Source: Ensembl

photoreceptor outer segment

Inferred from electronic annotation. Source: Ensembl

stereocilium bundle tip

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

microfilament motor activity

Inferred from electronic annotation. Source: Ensembl

protein serine/threonine kinase activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8WXR4-1)

Also known as: MYO3B.2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8WXR4-2)

Also known as: MYO3B.0;

The sequence of this isoform differs from the canonical sequence as follows:
     1245-1341: GSENGLAQKH...SSKGDSFAQH → AFPHYGCNFYGFRKWSCTEASNTSPTMSAAQNAE
Isoform 3 (identifier: Q8WXR4-3)

Also known as: MYO3B.1;

The sequence of this isoform differs from the canonical sequence as follows:
     1097-1123: Missing.
     1245-1341: GSENGLAQKH...SSKGDSFAQH → AFPHYGCNFYGFRKWSCTEASNTSPTMSAAQNAE
Isoform 4 (identifier: Q8WXR4-4)

Also known as: MYO3B.3;

The sequence of this isoform differs from the canonical sequence as follows:
     1097-1123: Missing.
Isoform 5 (identifier: Q8WXR4-5)

Also known as: MYO3B.4;

The sequence of this isoform differs from the canonical sequence as follows:
     1193-1341: HSQAQSSPKG...SSKGDSFAQH → WSFTLLLRLE...YAILLQISKD
Isoform 6 (identifier: Q8WXR4-6)

Also known as: MYO3B.5;

The sequence of this isoform differs from the canonical sequence as follows:
     1193-1341: Missing.
Isoform 7 (identifier: Q8WXR4-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLQSALLSTR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 13411341Myosin-IIIb
PRO_0000086415

Regions

Domain27 – 293267Protein kinase
Domain337 – 1059723Myosin head-like
Domain1060 – 108930IQ 1
Domain1087 – 111630IQ 2
Nucleotide binding33 – 419ATP By similarity

Sites

Active site1561Proton acceptor By similarity
Binding site561ATP By similarity

Natural variations

Alternative sequence11M → MLQSALLSTR in isoform 7.
VSP_023111
Alternative sequence1097 – 112327Missing in isoform 3 and isoform 4.
VSP_010162
Alternative sequence1193 – 1341149HSQAQ…SFAQH → WSFTLLLRLECNSMISADCN LRPLGSSDSPASASRVAGIT GIHKPRVLQKGAISSQDMQT STRFLGLICCLLGYAILLQI SKD in isoform 5.
VSP_010164
Alternative sequence1193 – 1341149Missing in isoform 6.
VSP_010165
Alternative sequence1245 – 134197GSENG…SFAQH → AFPHYGCNFYGFRKWSCTEA SNTSPTMSAAQNAE in isoform 2 and isoform 3.
VSP_010163
Natural variant211P → S. Ref.4
Corresponds to variant rs35391761 [ dbSNP | Ensembl ].
VAR_040886
Natural variant1851R → H. Ref.4
Corresponds to variant rs55911154 [ dbSNP | Ensembl ].
VAR_040887
Natural variant2671N → S. Ref.4
Corresponds to variant rs34509373 [ dbSNP | Ensembl ].
VAR_040888
Natural variant2751I → V. Ref.4
Corresponds to variant rs10209102 [ dbSNP | Ensembl ].
VAR_030605
Natural variant3091K → E. Ref.3 Ref.4
Corresponds to variant rs4668246 [ dbSNP | Ensembl ].
VAR_030606
Natural variant3161H → L. Ref.4
Corresponds to variant rs55633190 [ dbSNP | Ensembl ].
VAR_040889
Natural variant3521E → Q. Ref.4
Corresponds to variant rs56179904 [ dbSNP | Ensembl ].
VAR_040890
Natural variant3881N → S. Ref.4
Corresponds to variant rs34273653 [ dbSNP | Ensembl ].
VAR_040891
Natural variant4061A → T. Ref.4
Corresponds to variant rs10168181 [ dbSNP | Ensembl ].
VAR_030607
Natural variant6381Q → P. Ref.4
Corresponds to variant rs55911627 [ dbSNP | Ensembl ].
VAR_040892
Natural variant7701V → I. Ref.3 Ref.4
Corresponds to variant rs6736609 [ dbSNP | Ensembl ].
VAR_030608
Natural variant7731E → G. Ref.3 Ref.4
Corresponds to variant rs33962844 [ dbSNP | Ensembl ].
VAR_040893
Natural variant7981E → K.
Corresponds to variant rs11892763 [ dbSNP | Ensembl ].
VAR_030609
Natural variant9181R → Q. Ref.4
Corresponds to variant rs55769829 [ dbSNP | Ensembl ].
VAR_040894
Natural variant9691S → C. Ref.4
Corresponds to variant rs35857918 [ dbSNP | Ensembl ].
VAR_040895
Natural variant9901R → C. Ref.4
Corresponds to variant rs34236931 [ dbSNP | Ensembl ].
VAR_040896
Natural variant10821R → K. Ref.1 Ref.3
Corresponds to variant rs10185178 [ dbSNP | Ensembl ].
VAR_030610
Natural variant10921I → V. Ref.4
Corresponds to variant rs34219776 [ dbSNP | Ensembl ].
VAR_040897
Natural variant11371V → I. Ref.4
Corresponds to variant rs34546065 [ dbSNP | Ensembl ].
VAR_040898
Natural variant11651R → C. Ref.4
Corresponds to variant rs56052422 [ dbSNP | Ensembl ].
VAR_040899

Experimental info

Sequence conflict2611K → R in BAB71011. Ref.3
Sequence conflict5731T → A in BAB71011. Ref.3
Sequence conflict8701K → M in AAL57233. Ref.1
Sequence conflict8701K → M in AAO13799. Ref.1
Sequence conflict8701K → M in AAO13800. Ref.1
Sequence conflict8701K → M in AAO13801. Ref.1
Sequence conflict8701K → M in AAO13802. Ref.1
Sequence conflict8701K → M in AAO13803. Ref.1
Sequence conflict10811K → N in BAB71011. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (MYO3B.2) [UniParc].

Last modified May 18, 2010. Version 4.
Checksum: 76F84C571DAA269D

FASTA1,341151,829
        10         20         30         40         50         60 
MKHLYGLFHY NPMMLGLESL PDPTDTWEII ETIGKGTYGK VYKVTNKRDG SLAAVKILDP 

        70         80         90        100        110        120 
VSDMDEEIEA EYNILQFLPN HPNVVKFYGM FYKADHCVGG QLWLVLELCN GGSVTELVKG 

       130        140        150        160        170        180 
LLRCGQRLDE AMISYILYGA LLGLQHLHNN RIIHRDVKGN NILLTTEGGV KLVDFGVSAQ 

       190        200        210        220        230        240 
LTSTRLRRNT SVGTPFWMAP EVIACEQQYD SSYDARCDVW SLGITAIELG DGDPPLFDMH 

       250        260        270        280        290        300 
PVKTLFKIPR NPPPTLLHPE KWCEEFNHFI SQCLIKDFER RPSVTHLLDH PFIKGVHGKV 

       310        320        330        340        350        360 
LFLQKQLAKV LQDQKHQNPV AKTRHERMHT RRPYHVEDAE KYCLEDDLVN LEVLDEDTII 

       370        380        390        400        410        420 
HQLQKRYADL LIYTYVGDIL IALNPFQNLS IYSPQFSRLY HGVKRASNPP HIFASADAAY 

       430        440        450        460        470        480 
QCMVTLSKDQ CIVISGESGS GKTESAHLIV QHLTFLGKAN NQTLREKILQ VNSLVEAFGN 

       490        500        510        520        530        540 
SCTAINDNSS RFGKYLEMMF TPTGVVMGAR ISEYLLEKSR VIKQAAREKN FHIFYYIYAG 

       550        560        570        580        590        600 
LHHQKKLSDF RLPEEKPPRY IADETGRVMH DITSKESYRR QFEAIQHCFR IIGFTDKEVH 

       610        620        630        640        650        660 
SVYRILAGIL NIGNIEFAAI SSQHQTDKSE VPNAEALQNA ASVLCISPEE LQEALTSHCV 

       670        680        690        700        710        720 
VTRGETIIRA NTVDRAADVR DAMSKALYGR LFSWIVNRIN TLLQPDENIC SAGGGMNVGI 

       730        740        750        760        770        780 
LDIFGFENFQ RNSFEQLCIN IANEQIQYYF NQHVFALEQM EYQNEGIDAV PVEYEDNRPL 

       790        800        810        820        830        840 
LDMFLQKPLG LLALLDEESR FPQATDQTLV DKFEDNLRCK YFWRPKGVEL CFGIQHYAGK 

       850        860        870        880        890        900 
VLYDASGVLE KNRDTLPADV VVVLRTSENK LLQQLFSIPL TKTGNLAQTR ARITVASSSL 

       910        920        930        940        950        960 
PPHFSAGKAK VDTLEVIRHP EETTNMKRQT VASYFRYSLM DLLSKMVVGQ PHFVRCIKPN 

       970        980        990       1000       1010       1020 
DDREALQFSR ERVLAQLRST GILETVSIRR QGYSHRILFE EFVKRYYYLA FTAHQTPLAS 

      1030       1040       1050       1060       1070       1080 
KESCVAILEK SRLDHWVLGK TKVFLKYYHV EQLNLLLREV IGRVVVLQAY TKGWLGARRY 

      1090       1100       1110       1120       1130       1140 
KRVREKREKG AIAIQSAWRG YDARRKFKKI SNRRNESAAH NQAGDTSNQS SGPHSPVAAG 

      1150       1160       1170       1180       1190       1200 
TRGSAEVQDC SEPGDHKVLR GSVHRRSHSQ AESNNGRTQT SSNSPAVTEK NGHSQAQSSP 

      1210       1220       1230       1240       1250       1260 
KGCDIFAGHA NKHSVSGTDL LSSRICHPAP DQQGLSLWGA PQKPGSENGL AQKHRTPRRR 

      1270       1280       1290       1300       1310       1320 
CQQPKMLSSP EDTMYYNQLN GTLEYQGSKR KPRKLGQIKV LDGEDEYYKS LSPVDCIPEE 

      1330       1340 
NNSAHPSFFS SSSKGDSFAQ H 

« Hide

Isoform 2 (MYO3B.0) [UniParc].

Checksum: 08890776C830E4A2
Show »

FASTA1,278144,595
Isoform 3 (MYO3B.1) [UniParc].

Checksum: 361E5B30B7EC31A9
Show »

FASTA1,251141,381
Isoform 4 (MYO3B.3) [UniParc].

Checksum: F3A4479775B9C11B
Show »

FASTA1,314148,615
Isoform 5 (MYO3B.4) [UniParc].

Checksum: 5FA002DEC199A3B1
Show »

FASTA1,275144,329
Isoform 6 (MYO3B.5) [UniParc].

Checksum: 28488BBC7CD00706
Show »

FASTA1,192135,407
Isoform 7 [UniParc].

Checksum: 4DFD8DBA81A82CBE
Show »

FASTA1,350152,799

References

« Hide 'large scale' references
[1]"A class III myosin expressed in the retina is a potential candidate for Bardet-Biedl syndrome."
Dose A.C., Burnside B.
Genomics 79:621-624(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6), ALTERNATIVE SPLICING, VARIANT LYS-1082.
[2]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1104 (ISOFORM 7), VARIANTS GLU-309; ILE-770; GLY-773 AND LYS-1082.
Tissue: Kidney.
[4]"Patterns of somatic mutation in human cancer genomes."
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. expand/collapse author list , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-21; HIS-185; SER-267; VAL-275; GLU-309; LEU-316; GLN-352; SER-388; THR-406; PRO-638; ILE-770; GLY-773; GLN-918; CYS-969; CYS-990; VAL-1092; ILE-1137 AND CYS-1165.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF369908 mRNA. Translation: AAL57233.1.
AF391554 mRNA. Translation: AAO13799.1.
AF391555 mRNA. Translation: AAO13800.1.
AF391556 mRNA. Translation: AAO13801.1.
AF391557 mRNA. Translation: AAO13802.1.
AF391558 mRNA. Translation: AAO13803.1.
AC007277 Genomic DNA. No translation available.
AC012594 Genomic DNA. Translation: AAY24324.1.
AC068280 Genomic DNA. No translation available.
AC093402 Genomic DNA. No translation available.
AC114794 Genomic DNA. Translation: AAY24159.1.
AK055778 mRNA. Translation: BAB71011.1.
RefSeqNP_001077084.2. NM_001083615.3.
NP_620482.3. NM_138995.4.
UniGeneHs.671900.

3D structure databases

ProteinModelPortalQ8WXR4.
SMRQ8WXR4. Positions 15-327, 335-1105.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126621. 4 interactions.
IntActQ8WXR4. 4 interactions.

Chemistry

ChEMBLCHEMBL5654.
GuidetoPHARMACOLOGY2113.

PTM databases

PhosphoSiteQ8WXR4.

Polymorphism databases

DMDM296439486.

Proteomic databases

PaxDbQ8WXR4.
PRIDEQ8WXR4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317935; ENSP00000314650; ENSG00000071909. [Q8WXR4-3]
ENST00000334231; ENSP00000335100; ENSG00000071909. [Q8WXR4-7]
ENST00000408978; ENSP00000386213; ENSG00000071909. [Q8WXR4-1]
ENST00000409044; ENSP00000386497; ENSG00000071909. [Q8WXR4-4]
GeneID140469.
KEGGhsa:140469.
UCSCuc002ufv.4. human. [Q8WXR4-1]
uc002ufz.3. human. [Q8WXR4-4]

Organism-specific databases

CTD140469.
GeneCardsGC02P170998.
H-InvDBHIX0002580.
HGNCHGNC:15576. MYO3B.
MIM610040. gene.
neXtProtNX_Q8WXR4.
PharmGKBPA31406.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0515.
HOVERGENHBG052555.
InParanoidQ8WXR4.
KOK08834.
OMAHWVLGKT.
OrthoDBEOG7SJD3P.
PhylomeDBQ8WXR4.
TreeFamTF326512.

Enzyme and pathway databases

SignaLinkQ8WXR4.

Gene expression databases

ArrayExpressQ8WXR4.
BgeeQ8WXR4.
GenevestigatorQ8WXR4.

Family and domain databases

InterProIPR000048. IQ_motif_EF-hand-BS.
IPR011009. Kinase-like_dom.
IPR001609. Myosin_head_motor_dom.
IPR027417. P-loop_NTPase.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamPF00612. IQ. 1 hit.
PF00063. Myosin_head. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
PRINTSPR00193. MYOSINHEAVY.
SMARTSM00015. IQ. 2 hits.
SM00242. MYSc. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEPS50096. IQ. 2 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi140469.
NextBio84146.
PROQ8WXR4.
SOURCESearch...

Entry information

Entry nameMYO3B_HUMAN
AccessionPrimary (citable) accession number: Q8WXR4
Secondary accession number(s): B8ZZR2 expand/collapse secondary AC list , Q53QE1, Q53T08, Q8IX64, Q8IX65, Q8IX66, Q8IX67, Q8IX68, Q96N94
Entry history
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: May 18, 2010
Last modified: April 16, 2014
This is version 115 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM