Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8WXF5 (CRGN_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 92. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Gamma-crystallin N
Alternative name(s):
Gamma-N-crystallin
Gene names
Name:CRYGN
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length182 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subunit structure

Monomer By similarity.

Tissue specificity

Not specifically expressed in eye. Ref.1

Sequence similarities

Belongs to the beta/gamma-crystallin family.

Contains 3 beta/gamma crystallin 'Greek key' domains.

Caution

In contrast to the orthologous protein found in other species, the C-terminal part differs and lacks the fourth beta/gamma crystallin 'Greek key' domain. Moreover, its non-specific tissue specificity suggests that it may have lost its function (Ref.1).

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainRepeat
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8WXF5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8WXF5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     91-125: HGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWV → VSGPVHRRLSLPAGGTEGQPWQTVARNRGAWSSRL
     126-182: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 182182Gamma-crystallin N
PRO_0000311281

Regions

Domain6 – 4641Beta/gamma crystallin 'Greek key' 1
Domain47 – 8943Beta/gamma crystallin 'Greek key' 2
Domain95 – 13642Beta/gamma crystallin 'Greek key' 3

Natural variations

Alternative sequence91 – 12535HGEHF…SRGWV → VSGPVHRRLSLPAGGTEGQP WQTVARNRGAWSSRL in isoform 2.
VSP_029507
Alternative sequence126 – 18257Missing in isoform 2.
VSP_029508

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2002. Version 1.
Checksum: 761F381A8BDFDDF1

FASTA18220,624
        10         20         30         40         50         60 
MAQRSGKITL YEGKHFTGQK LEVFGDCDNF QDRGFMNRVN SIHVESGAWV CFNHPDFRGQ 

        70         80         90        100        110        120 
QFILEHGDYP DFFRWNSHSD HMGSCRPVGM HGEHFRLEIF EGCNFTGQCL EFLEDSPFLQ 

       130        140        150        160        170        180 
SRGWVKNCVN TIKVYGDGAA WSPRSFGAED FQLSSSLQSD QGPEEATTKP ATTQPPFLTA 


NL 

« Hide

Isoform 2 [UniParc].

Checksum: 41B1B2CBCF3D2CB8
Show »

FASTA12514,224

References

« Hide 'large scale' references
[1]"Gamma-N-crystallin and the evolution of the betagamma-crystallin superfamily in vertebrates."
Wistow G., Wyatt K., David L., Gao C., Bateman O., Bernstein S., Tomarev S., Segovia L., Slingsby C., Vihtelic T.
FEBS J. 272:2276-2291(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Testis.
[2]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF445455 mRNA. Translation: AAL40968.1.
CH471173 Genomic DNA. Translation: EAW53992.1.
BC100878 mRNA. Translation: AAI00879.1.
BC100879 mRNA. Translation: AAI00880.1.
BC100880 mRNA. Translation: AAI00881.1.
BC100881 mRNA. Translation: AAI00882.1.
RefSeqNP_653328.1. NM_144727.1.
XP_005250010.1. XM_005249953.1.
UniGeneHs.647104.

3D structure databases

ProteinModelPortalQ8WXF5.
SMRQ8WXF5. Positions 1-152.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000338613.

PTM databases

PhosphoSiteQ8WXF5.

Polymorphism databases

DMDM74727349.

Proteomic databases

PaxDbQ8WXF5.
PRIDEQ8WXF5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000337323; ENSP00000338613; ENSG00000127377. [Q8WXF5-1]
ENST00000491928; ENSP00000420157; ENSG00000127377. [Q8WXF5-2]
GeneID155051.
KEGGhsa:155051.
UCSCuc003wke.3. human. [Q8WXF5-1]
uc003wkf.3. human. [Q8WXF5-2]

Organism-specific databases

CTD155051.
GeneCardsGC07M151125.
HGNCHGNC:20458. CRYGN.
HPAHPA050788.
MIM609603. gene.
neXtProtNX_Q8WXF5.
PharmGKBPA134870586.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG46485.
HOGENOMHOG000234389.
InParanoidQ8WXF5.
OMAFYEGKHF.
OrthoDBEOG7JMGFJ.
PhylomeDBQ8WXF5.

Gene expression databases

BgeeQ8WXF5.
CleanExHS_CRYGN.
GenevestigatorQ8WXF5.

Family and domain databases

InterProIPR001064. Beta/gamma_crystallin.
IPR011024. G_crystallin-rel.
[Graphical view]
PfamPF00030. Crystall. 2 hits.
[Graphical view]
PRINTSPR01367. BGCRYSTALLIN.
SMARTSM00247. XTALbg. 1 hit.
[Graphical view]
SUPFAMSSF49695. SSF49695. 1 hit.
PROSITEPS50915. CRYSTALLIN_BETA_GAMMA. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi155051.
NextBio87359.
PROQ8WXF5.
SOURCESearch...

Entry information

Entry nameCRGN_HUMAN
AccessionPrimary (citable) accession number: Q8WXF5
Secondary accession number(s): Q496G6
Entry history
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: March 1, 2002
Last modified: March 19, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM