Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WXF5

- CRGN_HUMAN

UniProt

Q8WXF5 - CRGN_HUMAN

Protein

Gamma-crystallin N

Gene

CRYGN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
  1. Names & Taxonomyi

    Protein namesi
    Recommended name:
    Gamma-crystallin N
    Alternative name(s):
    Gamma-N-crystallin
    Gene namesi
    Name:CRYGN
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:20458. CRYGN.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134870586.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 182182Gamma-crystallin NPRO_0000311281Add
    BLAST

    Proteomic databases

    PaxDbiQ8WXF5.
    PRIDEiQ8WXF5.

    PTM databases

    PhosphoSiteiQ8WXF5.

    Expressioni

    Tissue specificityi

    Not specifically expressed in eye.1 Publication

    Gene expression databases

    BgeeiQ8WXF5.
    CleanExiHS_CRYGN.
    GenevestigatoriQ8WXF5.

    Organism-specific databases

    HPAiHPA050788.

    Interactioni

    Subunit structurei

    Monomer.By similarity

    Protein-protein interaction databases

    STRINGi9606.ENSP00000338613.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8WXF5.
    SMRiQ8WXF5. Positions 1-152.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini6 – 4641Beta/gamma crystallin 'Greek key' 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini47 – 8943Beta/gamma crystallin 'Greek key' 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini95 – 13642Beta/gamma crystallin 'Greek key' 3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the beta/gamma-crystallin family.Curated
    Contains 3 beta/gamma crystallin 'Greek key' domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG46485.
    HOGENOMiHOG000234389.
    InParanoidiQ8WXF5.
    OMAiGMHGEHY.
    OrthoDBiEOG7JMGFJ.
    PhylomeDBiQ8WXF5.

    Family and domain databases

    InterProiIPR001064. Beta/gamma_crystallin.
    IPR011024. G_crystallin-rel.
    [Graphical view]
    PfamiPF00030. Crystall. 2 hits.
    [Graphical view]
    PRINTSiPR01367. BGCRYSTALLIN.
    SMARTiSM00247. XTALbg. 1 hit.
    [Graphical view]
    SUPFAMiSSF49695. SSF49695. 1 hit.
    PROSITEiPS50915. CRYSTALLIN_BETA_GAMMA. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8WXF5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAQRSGKITL YEGKHFTGQK LEVFGDCDNF QDRGFMNRVN SIHVESGAWV    50
    CFNHPDFRGQ QFILEHGDYP DFFRWNSHSD HMGSCRPVGM HGEHFRLEIF 100
    EGCNFTGQCL EFLEDSPFLQ SRGWVKNCVN TIKVYGDGAA WSPRSFGAED 150
    FQLSSSLQSD QGPEEATTKP ATTQPPFLTA NL 182
    Length:182
    Mass (Da):20,624
    Last modified:March 1, 2002 - v1
    Checksum:i761F381A8BDFDDF1
    GO
    Isoform 2 (identifier: Q8WXF5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         91-125: HGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWV → VSGPVHRRLSLPAGGTEGQPWQTVARNRGAWSSRL
         126-182: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:125
    Mass (Da):14,224
    Checksum:i41B1B2CBCF3D2CB8
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei91 – 12535HGEHF…SRGWV → VSGPVHRRLSLPAGGTEGQP WQTVARNRGAWSSRL in isoform 2. 1 PublicationVSP_029507Add
    BLAST
    Alternative sequencei126 – 18257Missing in isoform 2. 1 PublicationVSP_029508Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF445455 mRNA. Translation: AAL40968.1.
    CH471173 Genomic DNA. Translation: EAW53992.1.
    BC100878 mRNA. Translation: AAI00879.1.
    BC100879 mRNA. Translation: AAI00880.1.
    BC100880 mRNA. Translation: AAI00881.1.
    BC100881 mRNA. Translation: AAI00882.1.
    CCDSiCCDS5926.1. [Q8WXF5-1]
    RefSeqiNP_653328.1. NM_144727.1. [Q8WXF5-1]
    XP_005250010.1. XM_005249953.1. [Q8WXF5-2]
    UniGeneiHs.647104.

    Genome annotation databases

    EnsembliENST00000337323; ENSP00000338613; ENSG00000127377. [Q8WXF5-1]
    ENST00000491928; ENSP00000420157; ENSG00000127377. [Q8WXF5-2]
    GeneIDi155051.
    KEGGihsa:155051.
    UCSCiuc003wke.3. human. [Q8WXF5-1]
    uc003wkf.3. human. [Q8WXF5-2]

    Polymorphism databases

    DMDMi74727349.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF445455 mRNA. Translation: AAL40968.1 .
    CH471173 Genomic DNA. Translation: EAW53992.1 .
    BC100878 mRNA. Translation: AAI00879.1 .
    BC100879 mRNA. Translation: AAI00880.1 .
    BC100880 mRNA. Translation: AAI00881.1 .
    BC100881 mRNA. Translation: AAI00882.1 .
    CCDSi CCDS5926.1. [Q8WXF5-1 ]
    RefSeqi NP_653328.1. NM_144727.1. [Q8WXF5-1 ]
    XP_005250010.1. XM_005249953.1. [Q8WXF5-2 ]
    UniGenei Hs.647104.

    3D structure databases

    ProteinModelPortali Q8WXF5.
    SMRi Q8WXF5. Positions 1-152.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000338613.

    PTM databases

    PhosphoSitei Q8WXF5.

    Polymorphism databases

    DMDMi 74727349.

    Proteomic databases

    PaxDbi Q8WXF5.
    PRIDEi Q8WXF5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000337323 ; ENSP00000338613 ; ENSG00000127377 . [Q8WXF5-1 ]
    ENST00000491928 ; ENSP00000420157 ; ENSG00000127377 . [Q8WXF5-2 ]
    GeneIDi 155051.
    KEGGi hsa:155051.
    UCSCi uc003wke.3. human. [Q8WXF5-1 ]
    uc003wkf.3. human. [Q8WXF5-2 ]

    Organism-specific databases

    CTDi 155051.
    GeneCardsi GC07M151125.
    HGNCi HGNC:20458. CRYGN.
    HPAi HPA050788.
    MIMi 609603. gene.
    neXtProti NX_Q8WXF5.
    PharmGKBi PA134870586.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG46485.
    HOGENOMi HOG000234389.
    InParanoidi Q8WXF5.
    OMAi GMHGEHY.
    OrthoDBi EOG7JMGFJ.
    PhylomeDBi Q8WXF5.

    Miscellaneous databases

    GenomeRNAii 155051.
    NextBioi 87359.
    PROi Q8WXF5.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8WXF5.
    CleanExi HS_CRYGN.
    Genevestigatori Q8WXF5.

    Family and domain databases

    InterProi IPR001064. Beta/gamma_crystallin.
    IPR011024. G_crystallin-rel.
    [Graphical view ]
    Pfami PF00030. Crystall. 2 hits.
    [Graphical view ]
    PRINTSi PR01367. BGCRYSTALLIN.
    SMARTi SM00247. XTALbg. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49695. SSF49695. 1 hit.
    PROSITEi PS50915. CRYSTALLIN_BETA_GAMMA. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Gamma-N-crystallin and the evolution of the betagamma-crystallin superfamily in vertebrates."
      Wistow G., Wyatt K., David L., Gao C., Bateman O., Bernstein S., Tomarev S., Segovia L., Slingsby C., Vihtelic T.
      FEBS J. 272:2276-2291(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).

    Entry informationi

    Entry nameiCRGN_HUMAN
    AccessioniPrimary (citable) accession number: Q8WXF5
    Secondary accession number(s): Q496G6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 13, 2007
    Last sequence update: March 1, 2002
    Last modified: October 1, 2014
    This is version 95 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3