Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WXF5

- CRGN_HUMAN

UniProt

Q8WXF5 - CRGN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Gamma-crystallin N

Gene

CRYGN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Gamma-crystallin N
Alternative name(s):
Gamma-N-crystallin
Gene namesi
Name:CRYGN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:20458. CRYGN.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134870586.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 182182Gamma-crystallin NPRO_0000311281Add
BLAST

Proteomic databases

PaxDbiQ8WXF5.
PRIDEiQ8WXF5.

PTM databases

PhosphoSiteiQ8WXF5.

Expressioni

Tissue specificityi

Not specifically expressed in eye.1 Publication

Gene expression databases

BgeeiQ8WXF5.
CleanExiHS_CRYGN.
GenevestigatoriQ8WXF5.

Organism-specific databases

HPAiHPA050788.

Interactioni

Subunit structurei

Monomer.By similarity

Protein-protein interaction databases

STRINGi9606.ENSP00000338613.

Structurei

3D structure databases

ProteinModelPortaliQ8WXF5.
SMRiQ8WXF5. Positions 2-178.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 4641Beta/gamma crystallin 'Greek key' 1PROSITE-ProRule annotationAdd
BLAST
Domaini47 – 8943Beta/gamma crystallin 'Greek key' 2PROSITE-ProRule annotationAdd
BLAST
Domaini95 – 13642Beta/gamma crystallin 'Greek key' 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the beta/gamma-crystallin family.Curated
Contains 3 beta/gamma crystallin 'Greek key' domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG46485.
GeneTreeiENSGT00760000118812.
HOGENOMiHOG000234389.
InParanoidiQ8WXF5.
OMAiGMHGEHY.
OrthoDBiEOG7JMGFJ.
PhylomeDBiQ8WXF5.

Family and domain databases

InterProiIPR001064. Beta/gamma_crystallin.
IPR011024. G_crystallin-rel.
[Graphical view]
PfamiPF00030. Crystall. 2 hits.
[Graphical view]
PRINTSiPR01367. BGCRYSTALLIN.
SMARTiSM00247. XTALbg. 1 hit.
[Graphical view]
SUPFAMiSSF49695. SSF49695. 1 hit.
PROSITEiPS50915. CRYSTALLIN_BETA_GAMMA. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WXF5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQRSGKITL YEGKHFTGQK LEVFGDCDNF QDRGFMNRVN SIHVESGAWV
60 70 80 90 100
CFNHPDFRGQ QFILEHGDYP DFFRWNSHSD HMGSCRPVGM HGEHFRLEIF
110 120 130 140 150
EGCNFTGQCL EFLEDSPFLQ SRGWVKNCVN TIKVYGDGAA WSPRSFGAED
160 170 180
FQLSSSLQSD QGPEEATTKP ATTQPPFLTA NL
Length:182
Mass (Da):20,624
Last modified:March 1, 2002 - v1
Checksum:i761F381A8BDFDDF1
GO
Isoform 2 (identifier: Q8WXF5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-125: HGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWV → VSGPVHRRLSLPAGGTEGQPWQTVARNRGAWSSRL
     126-182: Missing.

Note: No experimental confirmation available.

Show »
Length:125
Mass (Da):14,224
Checksum:i41B1B2CBCF3D2CB8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei91 – 12535HGEHF…SRGWV → VSGPVHRRLSLPAGGTEGQP WQTVARNRGAWSSRL in isoform 2. 1 PublicationVSP_029507Add
BLAST
Alternative sequencei126 – 18257Missing in isoform 2. 1 PublicationVSP_029508Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF445455 mRNA. Translation: AAL40968.1.
CH471173 Genomic DNA. Translation: EAW53992.1.
BC100878 mRNA. Translation: AAI00879.1.
BC100879 mRNA. Translation: AAI00880.1.
BC100880 mRNA. Translation: AAI00881.1.
BC100881 mRNA. Translation: AAI00882.1.
CCDSiCCDS5926.1. [Q8WXF5-1]
RefSeqiNP_653328.1. NM_144727.1. [Q8WXF5-1]
XP_005250010.1. XM_005249953.1. [Q8WXF5-2]
UniGeneiHs.647104.

Genome annotation databases

EnsembliENST00000337323; ENSP00000338613; ENSG00000127377. [Q8WXF5-1]
ENST00000491928; ENSP00000420157; ENSG00000127377. [Q8WXF5-2]
GeneIDi155051.
KEGGihsa:155051.
UCSCiuc003wke.3. human. [Q8WXF5-1]
uc003wkf.3. human. [Q8WXF5-2]

Polymorphism databases

DMDMi74727349.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF445455 mRNA. Translation: AAL40968.1 .
CH471173 Genomic DNA. Translation: EAW53992.1 .
BC100878 mRNA. Translation: AAI00879.1 .
BC100879 mRNA. Translation: AAI00880.1 .
BC100880 mRNA. Translation: AAI00881.1 .
BC100881 mRNA. Translation: AAI00882.1 .
CCDSi CCDS5926.1. [Q8WXF5-1 ]
RefSeqi NP_653328.1. NM_144727.1. [Q8WXF5-1 ]
XP_005250010.1. XM_005249953.1. [Q8WXF5-2 ]
UniGenei Hs.647104.

3D structure databases

ProteinModelPortali Q8WXF5.
SMRi Q8WXF5. Positions 2-178.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000338613.

PTM databases

PhosphoSitei Q8WXF5.

Polymorphism databases

DMDMi 74727349.

Proteomic databases

PaxDbi Q8WXF5.
PRIDEi Q8WXF5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000337323 ; ENSP00000338613 ; ENSG00000127377 . [Q8WXF5-1 ]
ENST00000491928 ; ENSP00000420157 ; ENSG00000127377 . [Q8WXF5-2 ]
GeneIDi 155051.
KEGGi hsa:155051.
UCSCi uc003wke.3. human. [Q8WXF5-1 ]
uc003wkf.3. human. [Q8WXF5-2 ]

Organism-specific databases

CTDi 155051.
GeneCardsi GC07M151125.
HGNCi HGNC:20458. CRYGN.
HPAi HPA050788.
MIMi 609603. gene.
neXtProti NX_Q8WXF5.
PharmGKBi PA134870586.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG46485.
GeneTreei ENSGT00760000118812.
HOGENOMi HOG000234389.
InParanoidi Q8WXF5.
OMAi GMHGEHY.
OrthoDBi EOG7JMGFJ.
PhylomeDBi Q8WXF5.

Miscellaneous databases

GenomeRNAii 155051.
NextBioi 87359.
PROi Q8WXF5.
SOURCEi Search...

Gene expression databases

Bgeei Q8WXF5.
CleanExi HS_CRYGN.
Genevestigatori Q8WXF5.

Family and domain databases

InterProi IPR001064. Beta/gamma_crystallin.
IPR011024. G_crystallin-rel.
[Graphical view ]
Pfami PF00030. Crystall. 2 hits.
[Graphical view ]
PRINTSi PR01367. BGCRYSTALLIN.
SMARTi SM00247. XTALbg. 1 hit.
[Graphical view ]
SUPFAMi SSF49695. SSF49695. 1 hit.
PROSITEi PS50915. CRYSTALLIN_BETA_GAMMA. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Gamma-N-crystallin and the evolution of the betagamma-crystallin superfamily in vertebrates."
    Wistow G., Wyatt K., David L., Gao C., Bateman O., Bernstein S., Tomarev S., Segovia L., Slingsby C., Vihtelic T.
    FEBS J. 272:2276-2291(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).

Entry informationi

Entry nameiCRGN_HUMAN
AccessioniPrimary (citable) accession number: Q8WXF5
Secondary accession number(s): Q496G6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: March 1, 2002
Last modified: October 29, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3