Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gamma-crystallin N

Gene

CRYGN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Gamma-crystallin N
Alternative name(s):
Gamma-N-crystallin
Gene namesi
Name:CRYGN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:20458. CRYGN.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134870586.

Polymorphism and mutation databases

BioMutaiCRYGN.
DMDMi74727349.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 182182Gamma-crystallin NPRO_0000311281Add
BLAST

Proteomic databases

PaxDbiQ8WXF5.
PRIDEiQ8WXF5.

PTM databases

PhosphoSiteiQ8WXF5.

Expressioni

Tissue specificityi

Not specifically expressed in eye.1 Publication

Gene expression databases

BgeeiQ8WXF5.
CleanExiHS_CRYGN.
GenevestigatoriQ8WXF5.

Organism-specific databases

HPAiHPA050788.

Interactioni

Subunit structurei

Monomer.By similarity

Protein-protein interaction databases

STRINGi9606.ENSP00000338613.

Structurei

3D structure databases

ProteinModelPortaliQ8WXF5.
SMRiQ8WXF5. Positions 2-178.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 4641Beta/gamma crystallin 'Greek key' 1PROSITE-ProRule annotationAdd
BLAST
Domaini47 – 8943Beta/gamma crystallin 'Greek key' 2PROSITE-ProRule annotationAdd
BLAST
Domaini95 – 13642Beta/gamma crystallin 'Greek key' 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the beta/gamma-crystallin family.Curated
Contains 3 beta/gamma crystallin 'Greek key' domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG46485.
GeneTreeiENSGT00760000118812.
HOGENOMiHOG000234389.
InParanoidiQ8WXF5.
OMAiFYRWNGH.
OrthoDBiEOG7JMGFJ.
PhylomeDBiQ8WXF5.

Family and domain databases

InterProiIPR001064. Beta/gamma_crystallin.
IPR011024. G_crystallin-rel.
[Graphical view]
PfamiPF00030. Crystall. 2 hits.
[Graphical view]
PRINTSiPR01367. BGCRYSTALLIN.
SMARTiSM00247. XTALbg. 1 hit.
[Graphical view]
SUPFAMiSSF49695. SSF49695. 1 hit.
PROSITEiPS50915. CRYSTALLIN_BETA_GAMMA. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WXF5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQRSGKITL YEGKHFTGQK LEVFGDCDNF QDRGFMNRVN SIHVESGAWV
60 70 80 90 100
CFNHPDFRGQ QFILEHGDYP DFFRWNSHSD HMGSCRPVGM HGEHFRLEIF
110 120 130 140 150
EGCNFTGQCL EFLEDSPFLQ SRGWVKNCVN TIKVYGDGAA WSPRSFGAED
160 170 180
FQLSSSLQSD QGPEEATTKP ATTQPPFLTA NL
Length:182
Mass (Da):20,624
Last modified:March 1, 2002 - v1
Checksum:i761F381A8BDFDDF1
GO
Isoform 2 (identifier: Q8WXF5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     91-125: HGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWV → VSGPVHRRLSLPAGGTEGQPWQTVARNRGAWSSRL
     126-182: Missing.

Note: No experimental confirmation available.

Show »
Length:125
Mass (Da):14,224
Checksum:i41B1B2CBCF3D2CB8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei91 – 12535HGEHF…SRGWV → VSGPVHRRLSLPAGGTEGQP WQTVARNRGAWSSRL in isoform 2. 1 PublicationVSP_029507Add
BLAST
Alternative sequencei126 – 18257Missing in isoform 2. 1 PublicationVSP_029508Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF445455 mRNA. Translation: AAL40968.1.
CH471173 Genomic DNA. Translation: EAW53992.1.
BC100878 mRNA. Translation: AAI00879.1.
BC100879 mRNA. Translation: AAI00880.1.
BC100880 mRNA. Translation: AAI00881.1.
BC100881 mRNA. Translation: AAI00882.1.
CCDSiCCDS5926.1. [Q8WXF5-1]
RefSeqiNP_653328.1. NM_144727.1. [Q8WXF5-1]
XP_005250010.1. XM_005249953.2. [Q8WXF5-2]
UniGeneiHs.647104.

Genome annotation databases

EnsembliENST00000337323; ENSP00000338613; ENSG00000127377. [Q8WXF5-1]
ENST00000491928; ENSP00000420157; ENSG00000127377. [Q8WXF5-2]
GeneIDi155051.
KEGGihsa:155051.
UCSCiuc003wke.3. human. [Q8WXF5-1]
uc003wkf.3. human. [Q8WXF5-2]

Polymorphism and mutation databases

BioMutaiCRYGN.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF445455 mRNA. Translation: AAL40968.1.
CH471173 Genomic DNA. Translation: EAW53992.1.
BC100878 mRNA. Translation: AAI00879.1.
BC100879 mRNA. Translation: AAI00880.1.
BC100880 mRNA. Translation: AAI00881.1.
BC100881 mRNA. Translation: AAI00882.1.
CCDSiCCDS5926.1. [Q8WXF5-1]
RefSeqiNP_653328.1. NM_144727.1. [Q8WXF5-1]
XP_005250010.1. XM_005249953.2. [Q8WXF5-2]
UniGeneiHs.647104.

3D structure databases

ProteinModelPortaliQ8WXF5.
SMRiQ8WXF5. Positions 2-178.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000338613.

PTM databases

PhosphoSiteiQ8WXF5.

Polymorphism and mutation databases

BioMutaiCRYGN.
DMDMi74727349.

Proteomic databases

PaxDbiQ8WXF5.
PRIDEiQ8WXF5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337323; ENSP00000338613; ENSG00000127377. [Q8WXF5-1]
ENST00000491928; ENSP00000420157; ENSG00000127377. [Q8WXF5-2]
GeneIDi155051.
KEGGihsa:155051.
UCSCiuc003wke.3. human. [Q8WXF5-1]
uc003wkf.3. human. [Q8WXF5-2]

Organism-specific databases

CTDi155051.
GeneCardsiGC07M151125.
HGNCiHGNC:20458. CRYGN.
HPAiHPA050788.
MIMi609603. gene.
neXtProtiNX_Q8WXF5.
PharmGKBiPA134870586.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG46485.
GeneTreeiENSGT00760000118812.
HOGENOMiHOG000234389.
InParanoidiQ8WXF5.
OMAiFYRWNGH.
OrthoDBiEOG7JMGFJ.
PhylomeDBiQ8WXF5.

Miscellaneous databases

GenomeRNAii155051.
NextBioi87359.
PROiQ8WXF5.
SOURCEiSearch...

Gene expression databases

BgeeiQ8WXF5.
CleanExiHS_CRYGN.
GenevestigatoriQ8WXF5.

Family and domain databases

InterProiIPR001064. Beta/gamma_crystallin.
IPR011024. G_crystallin-rel.
[Graphical view]
PfamiPF00030. Crystall. 2 hits.
[Graphical view]
PRINTSiPR01367. BGCRYSTALLIN.
SMARTiSM00247. XTALbg. 1 hit.
[Graphical view]
SUPFAMiSSF49695. SSF49695. 1 hit.
PROSITEiPS50915. CRYSTALLIN_BETA_GAMMA. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Gamma-N-crystallin and the evolution of the betagamma-crystallin superfamily in vertebrates."
    Wistow G., Wyatt K., David L., Gao C., Bateman O., Bernstein S., Tomarev S., Segovia L., Slingsby C., Vihtelic T.
    FEBS J. 272:2276-2291(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).

Entry informationi

Entry nameiCRGN_HUMAN
AccessioniPrimary (citable) accession number: Q8WXF5
Secondary accession number(s): Q496G6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: March 1, 2002
Last modified: April 29, 2015
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

In contrast to the orthologous protein found in other species, the C-terminal part differs and lacks the fourth beta/gamma crystallin 'Greek key' domain. Moreover, its non-specific tissue specificity suggests that it may have lost its function (PubMed:15853812).1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.