Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WXA3

- RUFY2_HUMAN

UniProt

Q8WXA3 - RUFY2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

RUN and FYVE domain-containing protein 2

Gene

RUFY2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri589 – 64759FYVE-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
RUN and FYVE domain-containing protein 2
Alternative name(s):
Rab4-interacting protein related
Gene namesi
Name:RUFY2
Synonyms:KIAA1537, RABIP4R
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:19761. RUFY2.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134935922.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 655655RUN and FYVE domain-containing protein 2PRO_0000245830Add
BLAST

Proteomic databases

MaxQBiQ8WXA3.
PaxDbiQ8WXA3.
PRIDEiQ8WXA3.

PTM databases

PhosphoSiteiQ8WXA3.

Expressioni

Tissue specificityi

Expressed in brain, lung and testis.1 Publication

Gene expression databases

BgeeiQ8WXA3.
CleanExiHS_RUFY2.
ExpressionAtlasiQ8WXA3. baseline and differential.
GenevestigatoriQ8WXA3.

Organism-specific databases

HPAiHPA039792.

Interactioni

Subunit structurei

Interacts with BMX.1 Publication

Protein-protein interaction databases

BioGridi120809. 7 interactions.
IntActiQ8WXA3. 4 interactions.
MINTiMINT-8247453.
STRINGi9606.ENSP00000373420.

Structurei

3D structure databases

ProteinModelPortaliQ8WXA3.
SMRiQ8WXA3. Positions 57-222, 450-648.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini86 – 218133RUNPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili259 – 583325Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 FYVE-type zinc finger.PROSITE-ProRule annotation
Contains 1 RUN domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri589 – 64759FYVE-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiNOG270133.
GeneTreeiENSGT00550000074558.
HOGENOMiHOG000030913.
HOVERGENiHBG057053.
InParanoidiQ8WXA3.
OMAiLQECQSK.
PhylomeDBiQ8WXA3.
TreeFamiTF323904.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR004012. Run.
IPR000306. Znf_FYVE.
IPR017455. Znf_FYVE-rel.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF01363. FYVE. 1 hit.
PF02759. RUN. 1 hit.
[Graphical view]
SMARTiSM00064. FYVE. 1 hit.
SM00593. RUN. 1 hit.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 1 hit.
PROSITEiPS50826. RUN. 1 hit.
PS50178. ZF_FYVE. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WXA3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGDCLGLGG SRGRHGNAPP PLFRPVPARV LRHSGRGLEV PRRPGARTGP
60 70 80 90 100
ATKDPTAVER ANLLNMAKLS IKGLIESALS FGRTLDSDYP PLQQFFVVME
110 120 130 140 150
HCLKHGLKVR KSFLSYNKTI WGPLELVEKL YPEAEEIGAS VRDLPGLKTP
160 170 180 190 200
LGRARAWLRL ALMQKKMADY LRCLIIQRDL LSEFYEYHAL MMEEEGAVIV
210 220 230 240 250
GLLVGLNVID ANLCVKGEDL DSQVGVIDFS MYLKNEEDIG NKERNVQIAA
260 270 280 290 300
ILDQKNYVEE LNRQLNSTVS SLHSRVDSLE KSNTKLIEEL AIAKNNIIKL
310 320 330 340 350
QEENHQLRSE NKLILMKTQQ HLEVTKVDVE TELQTYKHSR QGLDEMYNEA
360 370 380 390 400
RRQLRDESQL RQDVENELAV QVSMKHEIEL AMKLLEKDIH EKQDTLIGLR
410 420 430 440 450
QQLEEVKAIN IEMYQKLQGS EDGLKEKNEI IARLEEKTNK ITAAMRQLEQ
460 470 480 490 500
RLQQAEKAQM EAEDEDEKYL QECLSKSDSL QKQISQKEKQ LVQLETDLKI
510 520 530 540 550
EKEWRQTLQE DLQKEKDALS HLRNETQQII SLKKEFLNLQ DENQQLKKIY
560 570 580 590 600
HEQEQALQEL GNKLSESKLK IEDIKEANKA LQGLVWLKDK EATHCKLCEK
610 620 630 640 650
EFSLSKRKHH CRNCGEIFCN ACSDNELPLP SSPKPVRVCD SCHALLIQRC

SSNLP
Length:655
Mass (Da):75,055
Last modified:July 11, 2006 - v2
Checksum:i5A00F18CE81278BE
GO
Isoform 2 (identifier: Q8WXA3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MGGDCLGLGGSRGRHGNAPPPLFRPVPARVLRHSGRGLEVPRRPGARTGP → M

Note: No experimental confirmation available.

Show »
Length:606
Mass (Da):70,010
Checksum:iBD1100777070BE4A
GO
Isoform 3 (identifier: Q8WXA3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MGGDCLGLGG...PRRPGARTGP → MTFQVWGWRR...RRGMLTRRSL

Show »
Length:641
Mass (Da):74,081
Checksum:i9CF9E30FD8E1FC42
GO
Isoform 4 (identifier: Q8WXA3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MGGDCLGLGGSRGRHGNAPPPLFRPVPARVLRHSGRGLEVPRRPGARTGP → M
     148-182: KTPLGRARAWLRLALMQKKMADYLRCLIIQRDLLS → N
     451-500: RLQQAEKAQM...LVQLETDLKI → SDNDLLTQTR...QYKLVKDISF
     501-655: Missing.

Show »
Length:403
Mass (Da):46,136
Checksum:i76975482950240A0
GO
Isoform 5 (identifier: Q8WXA3-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: MGGDCLGLGG...MEHCLKHGLK → M
     451-486: RLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQ → SDNDLLTQTRTIAMSLVKCASSDTQDQYKLVKDISF
     487-655: Missing.

Note: No experimental confirmation available.

Show »
Length:379
Mass (Da):43,720
Checksum:i852A5A56D2257217
GO

Sequence cautioni

The sequence CAI17232.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti622 – 6221C → S.
Corresponds to variant rs11816774 [ dbSNP | Ensembl ].
VAR_060318

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 108108MGGDC…KHGLK → M in isoform 5. 1 PublicationVSP_054556Add
BLAST
Alternative sequencei1 – 5050MGGDC…ARTGP → M in isoform 2 and isoform 4. 2 PublicationsVSP_019788Add
BLAST
Alternative sequencei1 – 5050MGGDC…ARTGP → MTFQVWGWRREDASQVLAWV PDAEGGRRGMLTRRSL in isoform 3. 1 PublicationVSP_040463Add
BLAST
Alternative sequencei148 – 18235KTPLG…RDLLS → N in isoform 4. 1 PublicationVSP_040464Add
BLAST
Alternative sequencei451 – 50050RLQQA…TDLKI → SDNDLLTQTRTIAMSLVKCA SSDTQDQYKLVKDISF in isoform 4. 1 PublicationVSP_040465Add
BLAST
Alternative sequencei451 – 48636RLQQA…KQISQ → SDNDLLTQTRTIAMSLVKCA SSDTQDQYKLVKDISF in isoform 5. 1 PublicationVSP_054557Add
BLAST
Alternative sequencei487 – 655169Missing in isoform 5. 1 PublicationVSP_054558Add
BLAST
Alternative sequencei501 – 655155Missing in isoform 4. 1 PublicationVSP_040466Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461266 mRNA. Translation: AAL67520.1.
AK127019 mRNA. Translation: BAG54424.1.
AK294211 mRNA. Translation: BAG57521.1.
AL136233 Genomic DNA. Translation: CAI17232.1. Sequence problems.
AC016395 Genomic DNA. No translation available.
CH471083 Genomic DNA. Translation: EAW54294.1.
BC041092 mRNA. Translation: AAH41092.1.
AB040970 mRNA. Translation: BAA96061.1.
AF411980 mRNA. Translation: AAL04164.1.
CCDSiCCDS41534.1. [Q8WXA3-3]
CCDS44414.1. [Q8WXA3-4]
CCDS60544.1. [Q8WXA3-5]
RefSeqiNP_001035882.1. NM_001042417.1. [Q8WXA3-4]
NP_001265154.1. NM_001278225.1. [Q8WXA3-5]
NP_060457.4. NM_017987.4. [Q8WXA3-3]
XP_005270012.1. XM_005269955.2.
XP_006717974.1. XM_006717911.1. [Q8WXA3-2]
UniGeneiHs.653144.

Genome annotation databases

EnsembliENST00000388768; ENSP00000373420; ENSG00000204130. [Q8WXA3-3]
ENST00000399200; ENSP00000382151; ENSG00000204130. [Q8WXA3-4]
ENST00000454950; ENSP00000404986; ENSG00000204130. [Q8WXA3-5]
ENST00000602465; ENSP00000473462; ENSG00000204130. [Q8WXA3-2]
GeneIDi55680.
KEGGihsa:55680.
UCSCiuc001job.3. human. [Q8WXA3-3]
uc001joc.3. human. [Q8WXA3-4]
uc010qiw.2. human.

Polymorphism databases

DMDMi110287949.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461266 mRNA. Translation: AAL67520.1 .
AK127019 mRNA. Translation: BAG54424.1 .
AK294211 mRNA. Translation: BAG57521.1 .
AL136233 Genomic DNA. Translation: CAI17232.1 . Sequence problems.
AC016395 Genomic DNA. No translation available.
CH471083 Genomic DNA. Translation: EAW54294.1 .
BC041092 mRNA. Translation: AAH41092.1 .
AB040970 mRNA. Translation: BAA96061.1 .
AF411980 mRNA. Translation: AAL04164.1 .
CCDSi CCDS41534.1. [Q8WXA3-3 ]
CCDS44414.1. [Q8WXA3-4 ]
CCDS60544.1. [Q8WXA3-5 ]
RefSeqi NP_001035882.1. NM_001042417.1. [Q8WXA3-4 ]
NP_001265154.1. NM_001278225.1. [Q8WXA3-5 ]
NP_060457.4. NM_017987.4. [Q8WXA3-3 ]
XP_005270012.1. XM_005269955.2.
XP_006717974.1. XM_006717911.1. [Q8WXA3-2 ]
UniGenei Hs.653144.

3D structure databases

ProteinModelPortali Q8WXA3.
SMRi Q8WXA3. Positions 57-222, 450-648.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120809. 7 interactions.
IntActi Q8WXA3. 4 interactions.
MINTi MINT-8247453.
STRINGi 9606.ENSP00000373420.

PTM databases

PhosphoSitei Q8WXA3.

Polymorphism databases

DMDMi 110287949.

Proteomic databases

MaxQBi Q8WXA3.
PaxDbi Q8WXA3.
PRIDEi Q8WXA3.

Protocols and materials databases

DNASUi 55680.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000388768 ; ENSP00000373420 ; ENSG00000204130 . [Q8WXA3-3 ]
ENST00000399200 ; ENSP00000382151 ; ENSG00000204130 . [Q8WXA3-4 ]
ENST00000454950 ; ENSP00000404986 ; ENSG00000204130 . [Q8WXA3-5 ]
ENST00000602465 ; ENSP00000473462 ; ENSG00000204130 . [Q8WXA3-2 ]
GeneIDi 55680.
KEGGi hsa:55680.
UCSCi uc001job.3. human. [Q8WXA3-3 ]
uc001joc.3. human. [Q8WXA3-4 ]
uc010qiw.2. human.

Organism-specific databases

CTDi 55680.
GeneCardsi GC10M070100.
HGNCi HGNC:19761. RUFY2.
HPAi HPA039792.
MIMi 610328. gene.
neXtProti NX_Q8WXA3.
PharmGKBi PA134935922.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG270133.
GeneTreei ENSGT00550000074558.
HOGENOMi HOG000030913.
HOVERGENi HBG057053.
InParanoidi Q8WXA3.
OMAi LQECQSK.
PhylomeDBi Q8WXA3.
TreeFami TF323904.

Miscellaneous databases

ChiTaRSi RUFY2. human.
GenomeRNAii 55680.
NextBioi 35471559.
PROi Q8WXA3.
SOURCEi Search...

Gene expression databases

Bgeei Q8WXA3.
CleanExi HS_RUFY2.
ExpressionAtlasi Q8WXA3. baseline and differential.
Genevestigatori Q8WXA3.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR004012. Run.
IPR000306. Znf_FYVE.
IPR017455. Znf_FYVE-rel.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF01363. FYVE. 1 hit.
PF02759. RUN. 1 hit.
[Graphical view ]
SMARTi SM00064. FYVE. 1 hit.
SM00593. RUN. 1 hit.
[Graphical view ]
SUPFAMi SSF57903. SSF57903. 1 hit.
PROSITEi PS50826. RUN. 1 hit.
PS50178. ZF_FYVE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Interaction between tyrosine kinase Etk and a RUN-domain and FYVE-domain containing protein RUFY1. A possible role of Etk in regulation of vesicle trafficking."
    Yang J., Kim O., Wu J., Qiu Y.
    J. Biol. Chem. 277:30219-30226(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH BMX, TISSUE SPECIFICITY.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
    Tissue: Amygdala and Brain.
  3. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
  6. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 37-655 (ISOFORM 1).
    Tissue: Brain.
  7. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  8. "Rabip4R, a Run- and FYVE-domain containing protein related to Rabip4."
    Hong W.
    Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 66-655 (ISOFORM 1).
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiRUFY2_HUMAN
AccessioniPrimary (citable) accession number: Q8WXA3
Secondary accession number(s): B3KXB2
, B4DFR0, Q5TC48, Q8IW33, Q96P51, Q9P1Z1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: July 11, 2006
Last modified: November 26, 2014
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3