Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WXA3

- RUFY2_HUMAN

UniProt

Q8WXA3 - RUFY2_HUMAN

Protein

RUN and FYVE domain-containing protein 2

Gene

RUFY2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 2 (11 Jul 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri589 – 64759FYVE-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    RUN and FYVE domain-containing protein 2
    Alternative name(s):
    Rab4-interacting protein related
    Gene namesi
    Name:RUFY2
    Synonyms:KIAA1537, RABIP4R
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:19761. RUFY2.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134935922.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 655655RUN and FYVE domain-containing protein 2PRO_0000245830Add
    BLAST

    Proteomic databases

    MaxQBiQ8WXA3.
    PaxDbiQ8WXA3.
    PRIDEiQ8WXA3.

    PTM databases

    PhosphoSiteiQ8WXA3.

    Expressioni

    Tissue specificityi

    Expressed in brain, lung and testis.1 Publication

    Gene expression databases

    ArrayExpressiQ8WXA3.
    BgeeiQ8WXA3.
    CleanExiHS_RUFY2.
    GenevestigatoriQ8WXA3.

    Organism-specific databases

    HPAiHPA039792.

    Interactioni

    Subunit structurei

    Interacts with BMX.1 Publication

    Protein-protein interaction databases

    BioGridi120809. 5 interactions.
    IntActiQ8WXA3. 4 interactions.
    MINTiMINT-8247453.
    STRINGi9606.ENSP00000373420.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8WXA3.
    SMRiQ8WXA3. Positions 57-222, 450-648.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini86 – 218133RUNPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili259 – 583325Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 FYVE-type zinc finger.PROSITE-ProRule annotation
    Contains 1 RUN domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri589 – 64759FYVE-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG270133.
    HOGENOMiHOG000030913.
    HOVERGENiHBG057053.
    InParanoidiQ8WXA3.
    OMAiLQECQSK.
    PhylomeDBiQ8WXA3.
    TreeFamiTF323904.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    InterProiIPR004012. Run.
    IPR000306. Znf_FYVE.
    IPR017455. Znf_FYVE-rel.
    IPR011011. Znf_FYVE_PHD.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF01363. FYVE. 1 hit.
    PF02759. RUN. 1 hit.
    [Graphical view]
    SMARTiSM00064. FYVE. 1 hit.
    SM00593. RUN. 1 hit.
    [Graphical view]
    SUPFAMiSSF57903. SSF57903. 1 hit.
    PROSITEiPS50826. RUN. 1 hit.
    PS50178. ZF_FYVE. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8WXA3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGGDCLGLGG SRGRHGNAPP PLFRPVPARV LRHSGRGLEV PRRPGARTGP    50
    ATKDPTAVER ANLLNMAKLS IKGLIESALS FGRTLDSDYP PLQQFFVVME 100
    HCLKHGLKVR KSFLSYNKTI WGPLELVEKL YPEAEEIGAS VRDLPGLKTP 150
    LGRARAWLRL ALMQKKMADY LRCLIIQRDL LSEFYEYHAL MMEEEGAVIV 200
    GLLVGLNVID ANLCVKGEDL DSQVGVIDFS MYLKNEEDIG NKERNVQIAA 250
    ILDQKNYVEE LNRQLNSTVS SLHSRVDSLE KSNTKLIEEL AIAKNNIIKL 300
    QEENHQLRSE NKLILMKTQQ HLEVTKVDVE TELQTYKHSR QGLDEMYNEA 350
    RRQLRDESQL RQDVENELAV QVSMKHEIEL AMKLLEKDIH EKQDTLIGLR 400
    QQLEEVKAIN IEMYQKLQGS EDGLKEKNEI IARLEEKTNK ITAAMRQLEQ 450
    RLQQAEKAQM EAEDEDEKYL QECLSKSDSL QKQISQKEKQ LVQLETDLKI 500
    EKEWRQTLQE DLQKEKDALS HLRNETQQII SLKKEFLNLQ DENQQLKKIY 550
    HEQEQALQEL GNKLSESKLK IEDIKEANKA LQGLVWLKDK EATHCKLCEK 600
    EFSLSKRKHH CRNCGEIFCN ACSDNELPLP SSPKPVRVCD SCHALLIQRC 650
    SSNLP 655
    Length:655
    Mass (Da):75,055
    Last modified:July 11, 2006 - v2
    Checksum:i5A00F18CE81278BE
    GO
    Isoform 2 (identifier: Q8WXA3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MGGDCLGLGGSRGRHGNAPPPLFRPVPARVLRHSGRGLEVPRRPGARTGP → M

    Note: No experimental confirmation available.

    Show »
    Length:606
    Mass (Da):70,010
    Checksum:iBD1100777070BE4A
    GO
    Isoform 3 (identifier: Q8WXA3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MGGDCLGLGG...PRRPGARTGP → MTFQVWGWRR...RRGMLTRRSL

    Show »
    Length:641
    Mass (Da):74,081
    Checksum:i9CF9E30FD8E1FC42
    GO
    Isoform 4 (identifier: Q8WXA3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MGGDCLGLGGSRGRHGNAPPPLFRPVPARVLRHSGRGLEVPRRPGARTGP → M
         148-182: KTPLGRARAWLRLALMQKKMADYLRCLIIQRDLLS → N
         451-500: RLQQAEKAQM...LVQLETDLKI → SDNDLLTQTR...QYKLVKDISF
         501-655: Missing.

    Show »
    Length:403
    Mass (Da):46,136
    Checksum:i76975482950240A0
    GO
    Isoform 5 (identifier: Q8WXA3-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-108: MGGDCLGLGG...MEHCLKHGLK → M
         451-486: RLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQ → SDNDLLTQTRTIAMSLVKCASSDTQDQYKLVKDISF
         487-655: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:379
    Mass (Da):43,720
    Checksum:i852A5A56D2257217
    GO

    Sequence cautioni

    The sequence CAI17232.1 differs from that shown. Reason: Erroneous gene model prediction.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti622 – 6221C → S.
    Corresponds to variant rs11816774 [ dbSNP | Ensembl ].
    VAR_060318

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 108108MGGDC…KHGLK → M in isoform 5. 1 PublicationVSP_054556Add
    BLAST
    Alternative sequencei1 – 5050MGGDC…ARTGP → M in isoform 2 and isoform 4. 2 PublicationsVSP_019788Add
    BLAST
    Alternative sequencei1 – 5050MGGDC…ARTGP → MTFQVWGWRREDASQVLAWV PDAEGGRRGMLTRRSL in isoform 3. 1 PublicationVSP_040463Add
    BLAST
    Alternative sequencei148 – 18235KTPLG…RDLLS → N in isoform 4. 1 PublicationVSP_040464Add
    BLAST
    Alternative sequencei451 – 50050RLQQA…TDLKI → SDNDLLTQTRTIAMSLVKCA SSDTQDQYKLVKDISF in isoform 4. 1 PublicationVSP_040465Add
    BLAST
    Alternative sequencei451 – 48636RLQQA…KQISQ → SDNDLLTQTRTIAMSLVKCA SSDTQDQYKLVKDISF in isoform 5. 1 PublicationVSP_054557Add
    BLAST
    Alternative sequencei487 – 655169Missing in isoform 5. 1 PublicationVSP_054558Add
    BLAST
    Alternative sequencei501 – 655155Missing in isoform 4. 1 PublicationVSP_040466Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF461266 mRNA. Translation: AAL67520.1.
    AK127019 mRNA. Translation: BAG54424.1.
    AK294211 mRNA. Translation: BAG57521.1.
    AL136233 Genomic DNA. Translation: CAI17232.1. Sequence problems.
    AC016395 Genomic DNA. No translation available.
    CH471083 Genomic DNA. Translation: EAW54294.1.
    BC041092 mRNA. Translation: AAH41092.1.
    AB040970 mRNA. Translation: BAA96061.1.
    AF411980 mRNA. Translation: AAL04164.1.
    CCDSiCCDS41534.1. [Q8WXA3-3]
    CCDS44414.1. [Q8WXA3-4]
    CCDS60544.1. [Q8WXA3-5]
    RefSeqiNP_001035882.1. NM_001042417.1. [Q8WXA3-4]
    NP_001265154.1. NM_001278225.1. [Q8WXA3-5]
    NP_060457.4. NM_017987.4. [Q8WXA3-3]
    XP_005270012.1. XM_005269955.2.
    XP_006717974.1. XM_006717911.1. [Q8WXA3-2]
    UniGeneiHs.653144.

    Genome annotation databases

    EnsembliENST00000388768; ENSP00000373420; ENSG00000204130. [Q8WXA3-3]
    ENST00000399200; ENSP00000382151; ENSG00000204130. [Q8WXA3-4]
    ENST00000454950; ENSP00000404986; ENSG00000204130. [Q8WXA3-5]
    ENST00000602465; ENSP00000473462; ENSG00000204130. [Q8WXA3-2]
    GeneIDi55680.
    KEGGihsa:55680.
    UCSCiuc001job.3. human. [Q8WXA3-3]
    uc001joc.3. human. [Q8WXA3-4]

    Polymorphism databases

    DMDMi110287949.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF461266 mRNA. Translation: AAL67520.1 .
    AK127019 mRNA. Translation: BAG54424.1 .
    AK294211 mRNA. Translation: BAG57521.1 .
    AL136233 Genomic DNA. Translation: CAI17232.1 . Sequence problems.
    AC016395 Genomic DNA. No translation available.
    CH471083 Genomic DNA. Translation: EAW54294.1 .
    BC041092 mRNA. Translation: AAH41092.1 .
    AB040970 mRNA. Translation: BAA96061.1 .
    AF411980 mRNA. Translation: AAL04164.1 .
    CCDSi CCDS41534.1. [Q8WXA3-3 ]
    CCDS44414.1. [Q8WXA3-4 ]
    CCDS60544.1. [Q8WXA3-5 ]
    RefSeqi NP_001035882.1. NM_001042417.1. [Q8WXA3-4 ]
    NP_001265154.1. NM_001278225.1. [Q8WXA3-5 ]
    NP_060457.4. NM_017987.4. [Q8WXA3-3 ]
    XP_005270012.1. XM_005269955.2.
    XP_006717974.1. XM_006717911.1. [Q8WXA3-2 ]
    UniGenei Hs.653144.

    3D structure databases

    ProteinModelPortali Q8WXA3.
    SMRi Q8WXA3. Positions 57-222, 450-648.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120809. 5 interactions.
    IntActi Q8WXA3. 4 interactions.
    MINTi MINT-8247453.
    STRINGi 9606.ENSP00000373420.

    PTM databases

    PhosphoSitei Q8WXA3.

    Polymorphism databases

    DMDMi 110287949.

    Proteomic databases

    MaxQBi Q8WXA3.
    PaxDbi Q8WXA3.
    PRIDEi Q8WXA3.

    Protocols and materials databases

    DNASUi 55680.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000388768 ; ENSP00000373420 ; ENSG00000204130 . [Q8WXA3-3 ]
    ENST00000399200 ; ENSP00000382151 ; ENSG00000204130 . [Q8WXA3-4 ]
    ENST00000454950 ; ENSP00000404986 ; ENSG00000204130 . [Q8WXA3-5 ]
    ENST00000602465 ; ENSP00000473462 ; ENSG00000204130 . [Q8WXA3-2 ]
    GeneIDi 55680.
    KEGGi hsa:55680.
    UCSCi uc001job.3. human. [Q8WXA3-3 ]
    uc001joc.3. human. [Q8WXA3-4 ]

    Organism-specific databases

    CTDi 55680.
    GeneCardsi GC10M070100.
    HGNCi HGNC:19761. RUFY2.
    HPAi HPA039792.
    MIMi 610328. gene.
    neXtProti NX_Q8WXA3.
    PharmGKBi PA134935922.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG270133.
    HOGENOMi HOG000030913.
    HOVERGENi HBG057053.
    InParanoidi Q8WXA3.
    OMAi LQECQSK.
    PhylomeDBi Q8WXA3.
    TreeFami TF323904.

    Miscellaneous databases

    ChiTaRSi RUFY2. human.
    GenomeRNAii 55680.
    NextBioi 35471559.
    PROi Q8WXA3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8WXA3.
    Bgeei Q8WXA3.
    CleanExi HS_RUFY2.
    Genevestigatori Q8WXA3.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    InterProi IPR004012. Run.
    IPR000306. Znf_FYVE.
    IPR017455. Znf_FYVE-rel.
    IPR011011. Znf_FYVE_PHD.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF01363. FYVE. 1 hit.
    PF02759. RUN. 1 hit.
    [Graphical view ]
    SMARTi SM00064. FYVE. 1 hit.
    SM00593. RUN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57903. SSF57903. 1 hit.
    PROSITEi PS50826. RUN. 1 hit.
    PS50178. ZF_FYVE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Interaction between tyrosine kinase Etk and a RUN-domain and FYVE-domain containing protein RUFY1. A possible role of Etk in regulation of vesicle trafficking."
      Yang J., Kim O., Wu J., Qiu Y.
      J. Biol. Chem. 277:30219-30226(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH BMX, TISSUE SPECIFICITY.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
      Tissue: Amygdala and Brain.
    3. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    6. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 37-655 (ISOFORM 1).
      Tissue: Brain.
    7. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    8. "Rabip4R, a Run- and FYVE-domain containing protein related to Rabip4."
      Hong W.
      Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 66-655 (ISOFORM 1).
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiRUFY2_HUMAN
    AccessioniPrimary (citable) accession number: Q8WXA3
    Secondary accession number(s): B3KXB2
    , B4DFR0, Q5TC48, Q8IW33, Q96P51, Q9P1Z1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 11, 2006
    Last sequence update: July 11, 2006
    Last modified: October 1, 2014
    This is version 92 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3