Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NACHT, LRR and PYD domains-containing protein 7

Gene

NLRP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inhibits CASP1/caspase-1-dependent IL1B secretion.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi178 – 185ATPPROSITE-ProRule annotation8

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000167634-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 7
Alternative name(s):
Nucleotide-binding oligomerization domain protein 12
PYRIN-containing APAF1-like protein 3
Gene namesi
Name:NLRP7
Synonyms:NALP7, NOD12, PYPAF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:22947. NLRP7.

Pathology & Biotechi

Involvement in diseasei

Hydatidiform mole, recurrent, 1 (HYDM1)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by excessive trophoblast development that produces a growing mass of tissue inside the uterus at the beginning of a pregnancy. It leads to abnormal pregnancies with no embryo, and cystic degeneration of the chorionic villi.
See also OMIM:231090
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059035398L → R in HYDM1. 1 PublicationCorresponds to variant rs104895548dbSNPEnsembl.1
Natural variantiVAR_059036651P → S in HYDM1. 1 PublicationCorresponds to variant rs104895549dbSNPEnsembl.1
Natural variantiVAR_026711693R → P in HYDM1. 2 PublicationsCorresponds to variant rs104895502dbSNPEnsembl.1
Natural variantiVAR_059037693R → Q in HYDM1. 1 PublicationCorresponds to variant rs104895502dbSNPEnsembl.1
Natural variantiVAR_026712693R → W in HYDM1. 2 PublicationsCorresponds to variant rs104895506dbSNPEnsembl.1
Natural variantiVAR_059038716P → A in HYDM1. 1 PublicationCorresponds to variant rs104895550dbSNPEnsembl.1
Natural variantiVAR_059039721R → W in HYDM1. 1 PublicationCorresponds to variant rs104895525dbSNPEnsembl.1
Natural variantiVAR_059040761C → Y in HYDM1. 1 PublicationCorresponds to variant rs104895552dbSNPEnsembl.1
Natural variantiVAR_026713913N → S in HYDM1. 2 PublicationsCorresponds to variant rs104895503dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi199713.
MalaCardsiNLRP7.
MIMi231090. phenotype.
OpenTargetsiENSG00000167634.
ENSG00000274174.
ENSG00000274571.
ENSG00000275483.
ENSG00000276804.
ENSG00000277071.
ENSG00000277179.
ENSG00000277776.
ENSG00000277786.
Orphaneti254688. Complete hydatidiform mole.
254693. Partial hydatidiform mole.
PharmGKBiPA162398003.

Polymorphism and mutation databases

BioMutaiNLRP7.
DMDMi24212128.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000808951 – 980NACHT, LRR and PYD domains-containing protein 7Add BLAST980

Proteomic databases

EPDiQ8WX94.
MaxQBiQ8WX94.
PeptideAtlasiQ8WX94.
PRIDEiQ8WX94.

PTM databases

iPTMnetiQ8WX94.
PhosphoSitePlusiQ8WX94.

Expressioni

Tissue specificityi

Expressed in numerous tissues including uterus and ovary, with low levels in heart and brain. Not detected in skeletal muscle.2 Publications

Inductioni

By bacterial lipopolysaccharides (LPS) and IL1B/interleukin-1 beta in peripheral blood mononuclear cells.

Gene expression databases

BgeeiENSG00000167634.
CleanExiHS_NLRP7.
ExpressionAtlasiQ8WX94. baseline and differential.
GenevisibleiQ8WX94. HS.

Organism-specific databases

HPAiHPA051382.

Interactioni

Subunit structurei

Directly interacts with CASP1 and IL1B.1 Publication

Protein-protein interaction databases

BioGridi128265. 2 interactors.

Structurei

Secondary structure

1980
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi4 – 16Combined sources13
Helixi21 – 29Combined sources9
Helixi38 – 40Combined sources3
Helixi43 – 48Combined sources6
Helixi52 – 61Combined sources10
Helixi64 – 77Combined sources14
Helixi84 – 87Combined sources4
Turni88 – 91Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KM6NMR-A1-96[»]
ProteinModelPortaliQ8WX94.
SMRiQ8WX94.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WX94.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 93PyrinPROSITE-ProRule annotationAdd BLAST93
Domaini172 – 491NACHTPROSITE-ProRule annotationAdd BLAST320
Repeati614 – 638LRR 1Add BLAST25
Repeati674 – 697LRR 2Add BLAST24
Repeati760 – 784LRR 3Add BLAST25
Repeati788 – 810LRR 4Add BLAST23
Repeati817 – 840LRR 5Add BLAST24
Repeati845 – 868LRR 6Add BLAST24
Repeati874 – 897LRR 7Add BLAST24
Repeati902 – 928LRR 8Add BLAST27
Repeati933 – 957LRR 9Add BLAST25

Sequence similaritiesi

Belongs to the NLRP family.Curated
Contains 9 LRR (leucine-rich) repeats.Curated
Contains 1 NACHT domain.PROSITE-ProRule annotation
Contains 1 pyrin domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

GeneTreeiENSGT00860000133669.
HOGENOMiHOG000294064.
HOVERGENiHBG103856.
InParanoidiQ8WX94.
KOiK19409.
OMAiWAQQDLR.
OrthoDBiEOG091G01Q7.
PhylomeDBiQ8WX94.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
3.40.50.300. 1 hit.
3.80.10.10. 1 hit.
InterProiIPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR032675. L_dom-like.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF02758. PYRIN. 1 hit.
[Graphical view]
SMARTiSM01289. PYRIN. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF52540. SSF52540. 2 hits.
PROSITEiPS50824. DAPIN. 1 hit.
PS50837. NACHT. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WX94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSPQLEWTL QTLLEQLNED ELKSFKSLLW AFPLEDVLQK TPWSEVEEAD
60 70 80 90 100
GKKLAEILVN TSSENWIRNA TVNILEEMNL TELCKMAKAE MMEDGQVQEI
110 120 130 140 150
DNPELGDAEE DSELAKPGEK EGWRNSMEKQ SLVWKNTFWQ GDIDNFHDDV
160 170 180 190 200
TLRNQRFIPF LNPRTPRKLT PYTVVLHGPA GVGKTTLAKK CMLDWTDCNL
210 220 230 240 250
SPTLRYAFYL SCKELSRMGP CSFAELISKD WPELQDDIPS ILAQAQRILF
260 270 280 290 300
VVDGLDELKV PPGALIQDIC GDWEKKKPVP VLLGSLLKRK MLPRAALLVT
310 320 330 340 350
TRPRALRDLQ LLAQQPIYVR VEGFLEEDRR AYFLRHFGDE DQAMRAFELM
360 370 380 390 400
RSNAALFQLG SAPAVCWIVC TTLKLQMEKG EDPVPTCLTR TGLFLRFLCS
410 420 430 440 450
RFPQGAQLRG ALRTLSLLAA QGLWAQMSVF HREDLERLGV QESDLRLFLD
460 470 480 490 500
GDILRQDRVS KGCYSFIHLS FQQFLTALFY ALEKEEGEDR DGHAWDIGDV
510 520 530 540 550
QKLLSGEERL KNPDLIQVGH FLFGLANEKR AKELEATFGC RMSPDIKQEL
560 570 580 590 600
LQCKAHLHAN KPLSVTDLKE VLGCLYESQE EELAKVVVAP FKEISIHLTN
610 620 630 640 650
TSEVMHCSFS LKHCQDLQKL SLQVAKGVFL ENYMDFELDI EFERCTYLTI
660 670 680 690 700
PNWARQDLRS LRLWTDFCSL FSSNSNLKFL EVKQSFLSDS SVRILCDHVT
710 720 730 740 750
RSTCHLQKVE IKNVTPDTAY RDFCLAFIGK KTLTHLTLAG HIEWERTMML
760 770 780 790 800
MLCDLLRNHK CNLQYLRLGG HCATPEQWAE FFYVLKANQS LKHLRLSANV
810 820 830 840 850
LLDEGAMLLY KTMTRPKHFL QMLSLENCRL TEASCKDLAA VLVVSKKLTH
860 870 880 890 900
LCLAKNPIGD TGVKFLCEGL SYPDCKLQTL VLQQCSITKL GCRYLSEALQ
910 920 930 940 950
EACSLTNLDL SINQIARGLW ILCQALENPN CNLKHLRLKT YETNLEIKKL
960 970 980
LEEVKEKNPK LTIDCNASGA TAPPCCDFFC
Length:980
Mass (Da):111,807
Last modified:March 1, 2002 - v1
Checksum:i822AF2FD4338003D
GO
Isoform 2 (identifier: Q8WX94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     644-671: Missing.
     938-938: L → LWSCSLMPFYCQHLGSALLSNQKLETLDLGQNHLWKSGIIKLFGVLRQRTGSLKILRL

Note: No experimental confirmation available.
Show »
Length:1,009
Mass (Da):114,845
Checksum:iEB76450B0C05AE24
GO
Isoform 3 (identifier: Q8WX94-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     938-938: L → LWSCSLMPFYCQHLGSALLSNQKLETLDLGQNHLWKSGIIKLFGVLRQRTGSLKILRL

Note: No experimental confirmation available.
Show »
Length:1,037
Mass (Da):118,303
Checksum:iBB5642CADF5DA666
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti310 – 311QL → RI in AAI09126 (PubMed:15489334).Curated2
Sequence conflicti481A → T in AAI09126 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026710319V → I.Corresponds to variant rs775882dbSNPEnsembl.1
Natural variantiVAR_059035398L → R in HYDM1. 1 PublicationCorresponds to variant rs104895548dbSNPEnsembl.1
Natural variantiVAR_060103487G → E.Corresponds to variant rs775881dbSNPEnsembl.1
Natural variantiVAR_059036651P → S in HYDM1. 1 PublicationCorresponds to variant rs104895549dbSNPEnsembl.1
Natural variantiVAR_026711693R → P in HYDM1. 2 PublicationsCorresponds to variant rs104895502dbSNPEnsembl.1
Natural variantiVAR_059037693R → Q in HYDM1. 1 PublicationCorresponds to variant rs104895502dbSNPEnsembl.1
Natural variantiVAR_026712693R → W in HYDM1. 2 PublicationsCorresponds to variant rs104895506dbSNPEnsembl.1
Natural variantiVAR_059038716P → A in HYDM1. 1 PublicationCorresponds to variant rs104895550dbSNPEnsembl.1
Natural variantiVAR_059039721R → W in HYDM1. 1 PublicationCorresponds to variant rs104895525dbSNPEnsembl.1
Natural variantiVAR_059040761C → Y in HYDM1. 1 PublicationCorresponds to variant rs104895552dbSNPEnsembl.1
Natural variantiVAR_026713913N → S in HYDM1. 2 PublicationsCorresponds to variant rs104895503dbSNPEnsembl.1
Natural variantiVAR_026714971T → A.Corresponds to variant rs7256020dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016906644 – 671Missing in isoform 2. CuratedAdd BLAST28
Alternative sequenceiVSP_016907938L → LWSCSLMPFYCQHLGSALLS NQKLETLDLGQNHLWKSGII KLFGVLRQRTGSLKILRL in isoform 2 and isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF464765 mRNA. Translation: AAL69963.1.
AY154462 mRNA. Translation: AAO18158.1.
AC011476 Genomic DNA. No translation available.
BC109125 mRNA. Translation: AAI09126.1.
BK001113 mRNA. Translation: DAA01246.1.
CCDSiCCDS12912.1. [Q8WX94-2]
CCDS33109.1. [Q8WX94-1]
CCDS46183.1. [Q8WX94-3]
RefSeqiNP_001120727.1. NM_001127255.1. [Q8WX94-3]
NP_631915.2. NM_139176.3. [Q8WX94-2]
NP_996611.2. NM_206828.3. [Q8WX94-1]
XP_006723138.1. XM_006723075.3. [Q8WX94-3]
XP_006723139.1. XM_006723076.3. [Q8WX94-3]
XP_011524901.1. XM_011526599.2. [Q8WX94-3]
UniGeneiHs.351118.

Genome annotation databases

EnsembliENST00000328092; ENSP00000329568; ENSG00000167634. [Q8WX94-2]
ENST00000340844; ENSP00000339491; ENSG00000167634. [Q8WX94-1]
ENST00000588756; ENSP00000467123; ENSG00000167634. [Q8WX94-3]
ENST00000590030; ENSP00000465520; ENSG00000167634. [Q8WX94-1]
ENST00000592784; ENSP00000468706; ENSG00000167634. [Q8WX94-3]
ENST00000610424; ENSP00000482887; ENSG00000274571. [Q8WX94-3]
ENST00000610790; ENSP00000478726; ENSG00000274571. [Q8WX94-1]
ENST00000610853; ENSP00000478890; ENSG00000274571. [Q8WX94-2]
ENST00000610981; ENSP00000479459; ENSG00000277776. [Q8WX94-3]
ENST00000611597; ENSP00000481117; ENSG00000274571. [Q8WX94-1]
ENST00000613233; ENSP00000483203; ENSG00000277776. [Q8WX94-1]
ENST00000614879; ENSP00000484444; ENSG00000277071. [Q8WX94-1]
ENST00000615426; ENSP00000484426; ENSG00000277071. [Q8WX94-3]
ENST00000615699; ENSP00000480449; ENSG00000277786. [Q8WX94-1]
ENST00000618261; ENSP00000483353; ENSG00000277179. [Q8WX94-1]
ENST00000618343; ENSP00000480226; ENSG00000274174. [Q8WX94-3]
ENST00000618672; ENSP00000481452; ENSG00000277179. [Q8WX94-3]
ENST00000618740; ENSP00000484808; ENSG00000277786. [Q8WX94-3]
ENST00000618995; ENSP00000481809; ENSG00000276804. [Q8WX94-1]
ENST00000620183; ENSP00000480034; ENSG00000274174. [Q8WX94-1]
ENST00000620820; ENSP00000482551; ENSG00000276804. [Q8WX94-3]
ENST00000621238; ENSP00000481395; ENSG00000274571. [Q8WX94-3]
ENST00000621584; ENSP00000479541; ENSG00000275483. [Q8WX94-1]
ENST00000622199; ENSP00000482194; ENSG00000275483. [Q8WX94-3]
GeneIDi199713.
KEGGihsa:199713.
UCSCiuc002qih.4. human. [Q8WX94-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

INFEVERS

Repertory of FMF and hereditary autoinflammatory disorders mutations

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF464765 mRNA. Translation: AAL69963.1.
AY154462 mRNA. Translation: AAO18158.1.
AC011476 Genomic DNA. No translation available.
BC109125 mRNA. Translation: AAI09126.1.
BK001113 mRNA. Translation: DAA01246.1.
CCDSiCCDS12912.1. [Q8WX94-2]
CCDS33109.1. [Q8WX94-1]
CCDS46183.1. [Q8WX94-3]
RefSeqiNP_001120727.1. NM_001127255.1. [Q8WX94-3]
NP_631915.2. NM_139176.3. [Q8WX94-2]
NP_996611.2. NM_206828.3. [Q8WX94-1]
XP_006723138.1. XM_006723075.3. [Q8WX94-3]
XP_006723139.1. XM_006723076.3. [Q8WX94-3]
XP_011524901.1. XM_011526599.2. [Q8WX94-3]
UniGeneiHs.351118.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KM6NMR-A1-96[»]
ProteinModelPortaliQ8WX94.
SMRiQ8WX94.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128265. 2 interactors.

PTM databases

iPTMnetiQ8WX94.
PhosphoSitePlusiQ8WX94.

Polymorphism and mutation databases

BioMutaiNLRP7.
DMDMi24212128.

Proteomic databases

EPDiQ8WX94.
MaxQBiQ8WX94.
PeptideAtlasiQ8WX94.
PRIDEiQ8WX94.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328092; ENSP00000329568; ENSG00000167634. [Q8WX94-2]
ENST00000340844; ENSP00000339491; ENSG00000167634. [Q8WX94-1]
ENST00000588756; ENSP00000467123; ENSG00000167634. [Q8WX94-3]
ENST00000590030; ENSP00000465520; ENSG00000167634. [Q8WX94-1]
ENST00000592784; ENSP00000468706; ENSG00000167634. [Q8WX94-3]
ENST00000610424; ENSP00000482887; ENSG00000274571. [Q8WX94-3]
ENST00000610790; ENSP00000478726; ENSG00000274571. [Q8WX94-1]
ENST00000610853; ENSP00000478890; ENSG00000274571. [Q8WX94-2]
ENST00000610981; ENSP00000479459; ENSG00000277776. [Q8WX94-3]
ENST00000611597; ENSP00000481117; ENSG00000274571. [Q8WX94-1]
ENST00000613233; ENSP00000483203; ENSG00000277776. [Q8WX94-1]
ENST00000614879; ENSP00000484444; ENSG00000277071. [Q8WX94-1]
ENST00000615426; ENSP00000484426; ENSG00000277071. [Q8WX94-3]
ENST00000615699; ENSP00000480449; ENSG00000277786. [Q8WX94-1]
ENST00000618261; ENSP00000483353; ENSG00000277179. [Q8WX94-1]
ENST00000618343; ENSP00000480226; ENSG00000274174. [Q8WX94-3]
ENST00000618672; ENSP00000481452; ENSG00000277179. [Q8WX94-3]
ENST00000618740; ENSP00000484808; ENSG00000277786. [Q8WX94-3]
ENST00000618995; ENSP00000481809; ENSG00000276804. [Q8WX94-1]
ENST00000620183; ENSP00000480034; ENSG00000274174. [Q8WX94-1]
ENST00000620820; ENSP00000482551; ENSG00000276804. [Q8WX94-3]
ENST00000621238; ENSP00000481395; ENSG00000274571. [Q8WX94-3]
ENST00000621584; ENSP00000479541; ENSG00000275483. [Q8WX94-1]
ENST00000622199; ENSP00000482194; ENSG00000275483. [Q8WX94-3]
GeneIDi199713.
KEGGihsa:199713.
UCSCiuc002qih.4. human. [Q8WX94-1]

Organism-specific databases

CTDi199713.
DisGeNETi199713.
GeneCardsiNLRP7.
HGNCiHGNC:22947. NLRP7.
HPAiHPA051382.
MalaCardsiNLRP7.
MIMi231090. phenotype.
609661. gene.
neXtProtiNX_Q8WX94.
OpenTargetsiENSG00000167634.
ENSG00000274174.
ENSG00000274571.
ENSG00000275483.
ENSG00000276804.
ENSG00000277071.
ENSG00000277179.
ENSG00000277776.
ENSG00000277786.
Orphaneti254688. Complete hydatidiform mole.
254693. Partial hydatidiform mole.
PharmGKBiPA162398003.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00860000133669.
HOGENOMiHOG000294064.
HOVERGENiHBG103856.
InParanoidiQ8WX94.
KOiK19409.
OMAiWAQQDLR.
OrthoDBiEOG091G01Q7.
PhylomeDBiQ8WX94.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000167634-MONOMER.

Miscellaneous databases

ChiTaRSiNLRP7. human.
EvolutionaryTraceiQ8WX94.
GeneWikiiNLRP7.
GenomeRNAii199713.
PROiQ8WX94.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167634.
CleanExiHS_NLRP7.
ExpressionAtlasiQ8WX94. baseline and differential.
GenevisibleiQ8WX94. HS.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
3.40.50.300. 1 hit.
3.80.10.10. 1 hit.
InterProiIPR004020. DAPIN.
IPR011029. DEATH-like_dom.
IPR032675. L_dom-like.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF02758. PYRIN. 1 hit.
[Graphical view]
SMARTiSM01289. PYRIN. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF52540. SSF52540. 2 hits.
PROSITEiPS50824. DAPIN. 1 hit.
PS50837. NACHT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNALP7_HUMAN
AccessioniPrimary (citable) accession number: Q8WX94
Secondary accession number(s): E9PE16, Q32MH8, Q7RTR1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: March 1, 2002
Last modified: November 30, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.