SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WX93

- PALLD_HUMAN

UniProt

Q8WX93 - PALLD_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Palladin
Gene
PALLD, KIAA0992, CGI-151
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Cytoskeletal protein required for organization of normal actin cytoskeleton. Roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. May function as a scaffolding molecule with the potential to influence both actin polymerization and the assembly of existing actin filaments into higher-order arrays. Binds to proteins that bind to either monomeric or filamentous actin. Localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Different isoforms may have functional differences. Involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation. Involved in targeting ACTN to specific subcellular foci.3 Publications

GO - Molecular functioni

  1. muscle alpha-actinin binding Source: HGNC
  2. protein binding Source: IntAct

GO - Biological processi

  1. cytoskeleton organization Source: HGNC
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Palladin
Alternative name(s):
SIH002
Sarcoma antigen NY-SAR-77
Gene namesi
Name:PALLD
Synonyms:KIAA0992
ORF Names:CGI-151
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:17068. PALLD.

Subcellular locationi

Cytoplasmcytoskeleton. Cell junctionfocal adhesion. Cell projectionruffle. Cell projectionlamellipodium. CytoplasmmyofibrilsarcomereZ line
Note: Localizes to stress fibers and Z lines.4 Publications

GO - Cellular componenti

  1. Z disc Source: UniProtKB-SubCell
  2. actin filament Source: HGNC
  3. focal adhesion Source: UniProtKB-SubCell
  4. lamellipodium Source: UniProtKB-SubCell
  5. nucleus Source: HGNC
  6. ruffle Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Involvement in diseasei

Pancreatic cancer 1 (PNCA1) [MIM:606856]: A malignant neoplasm of the pancreas. Tumors can arise from both the exocrine and endocrine portions of the pancreas, but 95% of them develop from the exocrine portion, including the ductal epithelium, acinar cells, connective tissue, and lymphatic tissue.
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.3 Publications
Genetic variations in PALLD may be associated with myocardial infarction.

Organism-specific databases

MIMi606856. phenotype.
PharmGKBiPA142671205.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13831383Palladin
PRO_0000302720Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi292 ↔ 344 By similarity
Modified residuei401 – 4011Phosphoserine3 Publications
Disulfide bondi462 ↔ 521 By similarity
Modified residuei684 – 6841Phosphoserine1 Publication
Modified residuei688 – 6881Phosphoserine1 Publication
Modified residuei893 – 8931Phosphoserine6 Publications
Modified residuei979 – 9791Phosphoserine2 Publications
Modified residuei984 – 9841Phosphoserine2 Publications
Modified residuei1101 – 11011Phosphoserine1 Publication
Modified residuei1104 – 11041Phosphoserine2 Publications
Modified residuei1106 – 11061Phosphoserine1 Publication
Modified residuei1116 – 11161Phosphoserine2 Publications
Modified residuei1118 – 11181Phosphoserine; by PKB/AKT13 Publications
Modified residuei1121 – 11211Phosphoserine3 Publications
Disulfide bondi1156 ↔ 1208 By similarity

Post-translational modificationi

Phosphorylated predominantly on serines and, to a lesser extent, on tyrosines By similarity. Phosphorylation at Ser-1118 by PKB/AKT1 modulates cytoskeletal organization and cell motility.2 Publications

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

MaxQBiQ8WX93.
PaxDbiQ8WX93.
PRIDEiQ8WX93.

PTM databases

PhosphoSiteiQ8WX93.

Expressioni

Tissue specificityi

Detected in both muscle and non-muscle tissues. High expression in prostate, ovary, colon, and kidney. Not detected in spleen, skeletal muscle, lung and peripheral blood lymphocytes (at protein level). Protein is overexpressed in FA6, HPAF, IMIM-PC2, SUIT-2 and PancTu-II sporadic pancreatic cancer cell lines.1 Publication

Inductioni

Isoform 3 is expressed de novo. Isoform 4 is up-regulated by TGFB1 during myofibroblast differentiation.1 Publication

Gene expression databases

ArrayExpressiQ8WX93.
BgeeiQ8WX93.
GenevestigatoriQ8WX93.

Interactioni

Subunit structurei

Interacts with EPS8, LASP1 and VASP By similarity. Interacts with ACTN, ARGBP2, LPP, PFN1, SPIN90, SRC and EZR.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SORBS2O948752EBI-2803991,EBI-311323

Protein-protein interaction databases

BioGridi116662. 13 interactions.
IntActiQ8WX93. 5 interactions.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi1003 – 10053
Beta strandi1010 – 10134
Beta strandi1018 – 10247
Beta strandi1031 – 10355
Beta strandi1046 – 10527
Beta strandi1057 – 10648
Turni1067 – 10693
Beta strandi1074 – 10785
Beta strandi1084 – 10863
Beta strandi1090 – 10934
Beta strandi1136 – 11394
Beta strandi1143 – 11508
Beta strandi1155 – 11595
Beta strandi1165 – 11673
Beta strandi1169 – 11746
Beta strandi1179 – 11857
Beta strandi1191 – 11977
Helixi1200 – 12023
Beta strandi1204 – 12063
Beta strandi1208 – 12114
Beta strandi1216 – 12194
Beta strandi1222 – 12265

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DM2NMR-A1000-1096[»]
2DM3NMR-A1133-1229[»]
ProteinModelPortaliQ8WX93.
SMRiQ8WX93. Positions 1000-1096, 1133-1230.

Miscellaneous databases

EvolutionaryTraceiQ8WX93.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini271 – 36090Ig-like C2-type 1
Add
BLAST
Domaini440 – 539100Ig-like C2-type 2
Add
BLAST
Domaini1001 – 108585Ig-like C2-type 3
Add
BLAST
Domaini1135 – 122692Ig-like C2-type 4
Add
BLAST
Domaini1233 – 132492Ig-like C2-type 5
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni562 – 5665Interaction with VASP By similarity
Regioni646 – 67631Interaction with LASP1 By similarity
Add
BLAST
Regioni676 – 69621Interaction with ARGBP2, SPIN90 and SRC
Add
BLAST
Regioni766 – 83166Interaction with EPS8 By similarity
Add
BLAST
Regioni796 – 83136Interaction with ARGBP2, SPIN90, SRC and PFN1
Add
BLAST
Regioni819 – 8235Interaction with VASP By similarity
Regioni833 – 89058Interaction with ACTN
Add
BLAST
Regioni1137 – 122690Interaction with EZR
Add
BLAST
Regioni1236 – 132691Interaction with EZR
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi563 – 5675Poly-Pro
Compositional biasi634 – 864231Pro-rich
Add
BLAST

Sequence similaritiesi

Belongs to the myotilin/palladin family.

Keywords - Domaini

Immunoglobulin domain, Repeat

Phylogenomic databases

eggNOGiNOG136920.
HOGENOMiHOG000028074.
HOVERGENiHBG059166.
OMAiTPRVRWF.
OrthoDBiEOG77WWBP.
PhylomeDBiQ8WX93.
TreeFamiTF343193.

Family and domain databases

Gene3Di2.60.40.10. 6 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00408. IGc2. 5 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WX93-1) [UniParc]FASTAAdd to Basket

Also known as: 200-kDa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSGTSSHESF YDSLSDMQEE SKNTDFFPGL SAFLSQEEIN KSLDLARRAI     50
ADSETEDFDS EKEISQIFST SPASLCEHPS HKETKLGEHA SRRPQDNRST 100
PVQPLAEKQT KSISSPVSKR KPAMSPLLTR PSYIRSLRKA EKRGAKTPST 150
NVKPKTPHQR KGGPQSQLCD KAANLIEELT SIFKAAKPRN RSPNGESSSP 200
DSGYLSPKNQ PSALLSASAS QSPMEDQGEM EREVKSPGAR HCYQDNQDLA 250
VPHNRKSHPQ PHSALHFPAA PRFIQKLRSQ EVAEGSRVYL ECRVTGNPTP 300
RVRWFCEGKE LHNTPDIQIH CEGGDLHTLI IAEAFEDDTG RYTCLATNPS 350
GSDTTSAEVF IEGASSTDSD SESLAFKSRA GAMPQAQKKT TSVSLTIGSS 400
SPKTGVTTAV IQPLSVPVQQ VHSPTSYLCR PDGTTTAYFP PVFTKELQNT 450
AVAEGQVVVL ECRVRGAPPL QVQWFRQGSE IQDSPDFRIL QKKPRSTAEP 500
EEICTLVIAE TFPEDAGIFT CSARNDYGSA TSTAQLVVTS ANTENCSYES 550
MGESNNDHFQ HFPPPPPILE TSSLELASKK PSEIQQVNNP ELGLSRAALQ 600
MQFNAAERET NGVHPSRGVN GLINGKANSN KSLPTPAVLL SPTKEPPPLL 650
AKPKLDPLKL QQLQNQIRLE QEAGARQPPP APRSAPPSPP FPPPPAFPEL 700
AACTPPASPE PMSALASRSA PAMQSSGSFN YARPKQFIAA QNLGPASGHG 750
TPASSPSSSS LPSPMSPTPR QFGRAPVPPF AQPFGAEPEA PWGSSSPSPP 800
PPPPPVFSPT AAFPVPDVFP LPPPPPPLPS PGQASHCSSP ATRFGHSQTP 850
AAFLSALLPS QPPPAAVNAL GLPKGVTPAG FPKKASRTAR IASDEEIQGT 900
KDAVIQDLER KLRFKEDLLN NGQPRLTYEE RMARRLLGAD SATVFNIQEP 950
EEETANQEYK VSSCEQRLIS EIEYRLERSP VDESGDEVQY GDVPVENGMA 1000
PFFEMKLKHY KIFEGMPVTF TCRVAGNPKP KIYWFKDGKQ ISPKSDHYTI 1050
QRDLDGTCSL HTTASTLDDD GNYTIMAANP QGRISCTGRL MVQAVNQRGR 1100
SPRSPSGHPH VRRPRSRSRD SGDENEPIQE RFFRPHFLQA PGDLTVQEGK 1150
LCRMDCKVSG LPTPDLSWQL DGKPVRPDSA HKMLVRENGV HSLIIEPVTS 1200
RDAGIYTCIA TNRAGQNSFS LELVVAAKEA HKPPVFIEKL QNTGVADGYP 1250
VRLECRVLGV PPPQIFWKKE NESLTHSTDR VSMHQDNHGY ICLLIQGATK 1300
EDAGWYTVSA KNEAGIVSCT ARLDVYTQWH QQSQSTKPKK VRPSASRYAA 1350
LSDQGLDIKA AFQPEANPSH LTLNTALVES EDL 1383
Length:1,383
Mass (Da):150,564
Last modified:November 30, 2010 - v3
Checksum:i2CABAE1A6FEE855F
GO
Isoform 2 (identifier: Q8WX93-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.
     1326-1383: YTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL → YISRH

Show »
Length:1,106
Mass (Da):122,047
Checksum:i11CC06FA94B4758B
GO
Isoform 3 (identifier: Q8WX93-3) [UniParc]FASTAAdd to Basket

Also known as: 140-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-382: Missing.

Show »
Length:1,001
Mass (Da):108,632
Checksum:iE1A3F96F80B40B4B
GO
Isoform 4 (identifier: Q8WX93-4) [UniParc]FASTAAdd to Basket

Also known as: 90-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-711: Missing.

Show »
Length:672
Mass (Da):73,322
Checksum:i94168879EA796261
GO
Isoform 5 (identifier: Q8WX93-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.

Note: No experimental confirmation available.

Show »
Length:1,159
Mass (Da):127,826
Checksum:i0B1482F9B0C36C25
GO
Isoform 6 (identifier: Q8WX93-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     500-1383: PEEICTLVIA...NTALVESEDL → PDVLYVFVRVRCHQMKIQYYNLAHLISSWLSSFL

Note: No experimental confirmation available.

Show »
Length:533
Mass (Da):58,796
Checksum:i608AB2AD12868576
GO
Isoform 7 (identifier: Q8WX93-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-998: Missing.

Show »
Length:385
Mass (Da):42,933
Checksum:i15853FB78B8E41B9
GO
Isoform 8 (identifier: Q8WX93-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-382: Missing.
     656-879: Missing.

Show »
Length:777
Mass (Da):85,894
Checksum:iD0EE5BAF3028E2BB
GO
Isoform 9 (identifier: Q8WX93-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.
     957-957: Q → QDIGSPHASVGSPLDGQK
     1327-1383: TQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL → ISRH

Show »
Length:1,123
Mass (Da):123,693
Checksum:i12D8DFEEBE3DF2B2
GO

Sequence cautioni

The sequence AAO65174.1 differs from that shown. Reason: Frameshift at positions 1150 and 1154.
The sequence AAD34146.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAA76836.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAC04796.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti224 – 2241M → I.
Corresponds to variant rs7671781 [ dbSNP | Ensembl ].
VAR_034940
Natural varianti224 – 2241M → T.1 Publication
Corresponds to variant rs7655494 [ dbSNP | Ensembl ].
VAR_059401

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 998998Missing in isoform 7.
VSP_027925Add
BLAST
Alternative sequencei1 – 711711Missing in isoform 4.
VSP_027926Add
BLAST
Alternative sequencei1 – 382382Missing in isoform 3 and isoform 8.
VSP_027927Add
BLAST
Alternative sequencei500 – 1383884PEEIC…ESEDL → PDVLYVFVRVRCHQMKIQYY NLAHLISSWLSSFL in isoform 6.
VSP_027928Add
BLAST
Alternative sequencei656 – 879224Missing in isoform 2, isoform 5, isoform 8 and isoform 9.
VSP_027929Add
BLAST
Alternative sequencei957 – 9571Q → QDIGSPHASVGSPLDGQK in isoform 9.
VSP_043794
Alternative sequencei1326 – 138358YTQWH…ESEDL → YISRH in isoform 2.
VSP_027930Add
BLAST
Alternative sequencei1327 – 138357TQWHQ…ESEDL → ISRH in isoform 9.
VSP_043795Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti277 – 2771L → P in BAC04796. 1 Publication
Sequence conflicti472 – 4721V → D in BAC04796. 1 Publication
Sequence conflicti611 – 6111N → S in AAL69964. 1 Publication
Sequence conflicti847 – 8471S → G in BAA76836. 1 Publication
Sequence conflicti1126 – 11261E → D in AAO65174. 1 Publication
Sequence conflicti1146 – 11461V → G in AAO65174. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF077041 mRNA. Translation: AAD27774.1.
AF464873 mRNA. Translation: AAL69964.1.
AB023209 mRNA. Translation: BAA76836.1. Different initiation.
AF151909 mRNA. Translation: AAD34146.1. Different initiation.
AK095512 mRNA. Translation: BAG53074.1.
AK096458 mRNA. Translation: BAC04796.1. Different initiation.
AC079858 Genomic DNA. No translation available.
AC079926 Genomic DNA. No translation available.
AC080188 Genomic DNA. No translation available.
AC084353 Genomic DNA. No translation available.
AC115538 Genomic DNA. No translation available.
BC013867 mRNA. Translation: AAH13867.2.
BC144666 mRNA. Translation: AAI44667.1.
AY211921 mRNA. Translation: AAO65174.1. Frameshift.
BX537391 mRNA. Translation: CAD97633.1.
CCDSiCCDS34098.1. [Q8WX93-2]
CCDS54818.1. [Q8WX93-9]
CCDS54819.1. [Q8WX93-8]
CCDS54820.1. [Q8WX93-4]
PIRiT13078.
RefSeqiNP_001159580.1. NM_001166108.1. [Q8WX93-9]
NP_001159581.1. NM_001166109.1. [Q8WX93-8]
NP_001159582.1. NM_001166110.1. [Q8WX93-4]
NP_057165.3. NM_016081.3. [Q8WX93-2]
XP_005262919.1. XM_005262862.2. [Q8WX93-1]
UniGeneiHs.151220.

Genome annotation databases

EnsembliENST00000261509; ENSP00000261509; ENSG00000129116. [Q8WX93-2]
ENST00000335742; ENSP00000336735; ENSG00000129116. [Q8WX93-3]
ENST00000505667; ENSP00000425556; ENSG00000129116. [Q8WX93-9]
ENST00000507735; ENSP00000424016; ENSG00000129116. [Q8WX93-4]
ENST00000512127; ENSP00000426947; ENSG00000129116. [Q8WX93-8]
GeneIDi23022.
KEGGihsa:23022.
UCSCiuc003irv.3. human. [Q8WX93-8]
uc003irw.3. human. [Q8WX93-4]
uc003irx.3. human. [Q8WX93-7]
uc011cjx.2. human. [Q8WX93-9]

Polymorphism databases

DMDMi313104206.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF077041 mRNA. Translation: AAD27774.1 .
AF464873 mRNA. Translation: AAL69964.1 .
AB023209 mRNA. Translation: BAA76836.1 . Different initiation.
AF151909 mRNA. Translation: AAD34146.1 . Different initiation.
AK095512 mRNA. Translation: BAG53074.1 .
AK096458 mRNA. Translation: BAC04796.1 . Different initiation.
AC079858 Genomic DNA. No translation available.
AC079926 Genomic DNA. No translation available.
AC080188 Genomic DNA. No translation available.
AC084353 Genomic DNA. No translation available.
AC115538 Genomic DNA. No translation available.
BC013867 mRNA. Translation: AAH13867.2 .
BC144666 mRNA. Translation: AAI44667.1 .
AY211921 mRNA. Translation: AAO65174.1 . Frameshift.
BX537391 mRNA. Translation: CAD97633.1 .
CCDSi CCDS34098.1. [Q8WX93-2 ]
CCDS54818.1. [Q8WX93-9 ]
CCDS54819.1. [Q8WX93-8 ]
CCDS54820.1. [Q8WX93-4 ]
PIRi T13078.
RefSeqi NP_001159580.1. NM_001166108.1. [Q8WX93-9 ]
NP_001159581.1. NM_001166109.1. [Q8WX93-8 ]
NP_001159582.1. NM_001166110.1. [Q8WX93-4 ]
NP_057165.3. NM_016081.3. [Q8WX93-2 ]
XP_005262919.1. XM_005262862.2. [Q8WX93-1 ]
UniGenei Hs.151220.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2DM2 NMR - A 1000-1096 [» ]
2DM3 NMR - A 1133-1229 [» ]
ProteinModelPortali Q8WX93.
SMRi Q8WX93. Positions 1000-1096, 1133-1230.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116662. 13 interactions.
IntActi Q8WX93. 5 interactions.

Protein family/group databases

MEROPSi I43.001.

PTM databases

PhosphoSitei Q8WX93.

Polymorphism databases

DMDMi 313104206.

Proteomic databases

MaxQBi Q8WX93.
PaxDbi Q8WX93.
PRIDEi Q8WX93.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261509 ; ENSP00000261509 ; ENSG00000129116 . [Q8WX93-2 ]
ENST00000335742 ; ENSP00000336735 ; ENSG00000129116 . [Q8WX93-3 ]
ENST00000505667 ; ENSP00000425556 ; ENSG00000129116 . [Q8WX93-9 ]
ENST00000507735 ; ENSP00000424016 ; ENSG00000129116 . [Q8WX93-4 ]
ENST00000512127 ; ENSP00000426947 ; ENSG00000129116 . [Q8WX93-8 ]
GeneIDi 23022.
KEGGi hsa:23022.
UCSCi uc003irv.3. human. [Q8WX93-8 ]
uc003irw.3. human. [Q8WX93-4 ]
uc003irx.3. human. [Q8WX93-7 ]
uc011cjx.2. human. [Q8WX93-9 ]

Organism-specific databases

CTDi 23022.
GeneCardsi GC04P169418.
HGNCi HGNC:17068. PALLD.
MIMi 606856. phenotype.
608092. gene.
neXtProti NX_Q8WX93.
PharmGKBi PA142671205.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG136920.
HOGENOMi HOG000028074.
HOVERGENi HBG059166.
OMAi TPRVRWF.
OrthoDBi EOG77WWBP.
PhylomeDBi Q8WX93.
TreeFami TF343193.

Miscellaneous databases

ChiTaRSi PALLD. human.
EvolutionaryTracei Q8WX93.
GeneWikii Palladin.
GenomeRNAii 23022.
NextBioi 43970.
PROi Q8WX93.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8WX93.
Bgeei Q8WX93.
Genevestigatori Q8WX93.

Family and domain databases

Gene3Di 2.60.40.10. 6 hits.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
[Graphical view ]
Pfami PF07679. I-set. 5 hits.
[Graphical view ]
SMARTi SM00408. IGc2. 5 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Human SIH002 gene."
    Liu T., Zhang J., Ye M., Zhang Q., Fu G., Zhou J., Wu J., Shen Y., Yu M., Chen S., Mao M., Chen Z.
    Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
  2. Lockwood S.K.
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain.
  4. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
    Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
    Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 22-1383 (ISOFORM 6), VARIANT THR-224.
    Tissue: Tongue.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 874-1383 (ISOFORM 1).
    Tissue: Placenta.
  8. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 874-1160 (ISOFORM 1).
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1188-1383 (ISOFORM 2).
    Tissue: Heart.
  10. "Characterization of human palladin, a microfilament-associated protein."
    Mykkaenen O.-M., Groenholm M., Roenty M., Lalowski M., Salmikangas P., Suila H., Carpen O.
    Mol. Biol. Cell 12:3060-3073(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH EZR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  11. "Molecular analysis of the interaction between palladin and alpha-actinin."
    Roenty M., Taivainen A., Moza M., Otey C.A., Carpen O.
    FEBS Lett. 566:30-34(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ACTN.
  12. "Involvement of palladin and alpha-actinin in targeting of the Abl/Arg kinase adaptor ArgBP2 to the actin cytoskeleton."
    Roenty M., Taivainen A., Moza M., Kruh G.D., Ehler E., Carpen O.
    Exp. Cell Res. 310:88-98(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ARGBP2, SUBCELLULAR LOCATION.
  13. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-893 AND SER-1121, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. Cited for: INTERACTION WITH PFN1.
  15. "Isoform-specific regulation of the actin-organizing protein Palladin during TGF-beta1-induced myofibroblast differentiation."
    Roenty M.J., Leivonen S.-K., Hinz B., Rachlin A., Otey C.A., Kaehaeri V.-M., Carpen O.M.
    J. Invest. Dermatol. 126:2387-2396(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION (ISOFORMS 3 AND 4), INDUCTION.
  16. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-401 AND SER-893, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. "Angiotensin II, focal adhesion kinase, and PRX1 enhance smooth muscle expression of lipoma preferred partner and its newly identified binding partner palladin to promote cell migration."
    Jin L., Kern M.J., Otey C.A., Wamhoff B.R., Somlyo A.V.
    Circ. Res. 100:817-825(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH LPP, SUBCELLULAR LOCATION.
  18. "Palladin interacts with SH3 domains of SPIN90 and Src and is required for Src-induced cytoskeletal remodeling."
    Ronty M., Taivainen A., Heiska L., Otey C., Ehler E., Song W.K., Carpen O.
    Exp. Cell Res. 313:2575-2585(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH AND SRC, SUBCELLULAR LOCATION, PHOSPHORYLATION.
  19. Cited for: INVOLVEMENT IN PNCA1.
  20. Cited for: ASSOCIATION WITH MYOCARDIAL INFARCTION.
  21. "The P239S palladin variant does not account for a significant fraction of hereditary or early onset pancreas cancer."
    Zogopoulous G., Rothenmund H., Eppel A., Ash C., Akbari M.R., Hedley D., Narod S.A., Gallinger S.
    Hum. Genet. 121:635-637(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN PNCA1.
  22. "Palladin mutation causes familial pancreatic cancer: absence in European families."
    Slater E., Amrillaeva V., Fendrich V., Bartsch D., Earl J., Vitone L.J., Neoptolemos J.P., Greenhalf W.
    PLoS Med. 4:774-775(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: QUESTIONING OF INVOLVEMENT IN PNCA1.
  23. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-401; SER-893; SER-979 AND SER-984, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  24. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-893, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  25. "The actin-bundling protein palladin is an Akt1-specific substrate that regulates breast cancer cell migration."
    Chin Y.R., Toker A.
    Mol. Cell 38:333-344(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-1118.
  26. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-401; SER-684; SER-688; SER-893; SER-979; SER-984; SER-1101; SER-1104; SER-1106; SER-1116; SER-1118 AND SER-1121, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  27. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  28. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-893; SER-1104; SER-1116; SER-1118 AND SER-1121, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  29. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  30. "Expression, crystallization and preliminary X-ray studies of the immunoglobulin-like domain 3 of human palladin."
    Liang W., Yang H., Xue X., Huang Q., Bartlam M., Chen S.
    Acta Crystallogr. F 62:556-558(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 1233-1324.
  31. "Solution structure of the first and second Ig domains of human palladin."
    RIKEN structural genomics initiative (RSGI)
    Submitted (APR-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 1000-1230.

Entry informationi

Entry nameiPALLD_HUMAN
AccessioniPrimary (citable) accession number: Q8WX93
Secondary accession number(s): B3KTG2
, B5MD56, B7ZMM5, Q7L3E0, Q7Z3W0, Q86WE8, Q8N1M2, Q9UGA0, Q9UQF5, Q9Y2J6, Q9Y3E9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: November 30, 2010
Last modified: July 9, 2014
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi