Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WX93

- PALLD_HUMAN

UniProt

Q8WX93 - PALLD_HUMAN

Protein

Palladin

Gene

PALLD

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 3 (30 Nov 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cytoskeletal protein required for organization of normal actin cytoskeleton. Roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. May function as a scaffolding molecule with the potential to influence both actin polymerization and the assembly of existing actin filaments into higher-order arrays. Binds to proteins that bind to either monomeric or filamentous actin. Localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Different isoforms may have functional differences. Involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation. Involved in targeting ACTN to specific subcellular foci.3 Publications

    GO - Molecular functioni

    1. muscle alpha-actinin binding Source: HGNC
    2. protein binding Source: IntAct

    GO - Biological processi

    1. cytoskeleton organization Source: HGNC

    Keywords - Ligandi

    Actin-binding

    Protein family/group databases

    MEROPSiI43.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Palladin
    Alternative name(s):
    SIH002
    Sarcoma antigen NY-SAR-77
    Gene namesi
    Name:PALLD
    Synonyms:KIAA0992
    ORF Names:CGI-151
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:17068. PALLD.

    Subcellular locationi

    Cytoplasmcytoskeleton. Cell junctionfocal adhesion. Cell projectionruffle. Cell projectionlamellipodium. CytoplasmmyofibrilsarcomereZ line
    Note: Localizes to stress fibers and Z lines.

    GO - Cellular componenti

    1. actin filament Source: HGNC
    2. focal adhesion Source: UniProtKB-SubCell
    3. lamellipodium Source: UniProtKB-SubCell
    4. nucleus Source: HGNC
    5. ruffle Source: UniProtKB-SubCell
    6. Z disc Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell projection, Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Involvement in diseasei

    Pancreatic cancer 1 (PNCA1) [MIM:606856]: A malignant neoplasm of the pancreas. Tumors can arise from both the exocrine and endocrine portions of the pancreas, but 95% of them develop from the exocrine portion, including the ductal epithelium, acinar cells, connective tissue, and lymphatic tissue.2 Publications
    Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Genetic variations in PALLD may be associated with myocardial infarction.

    Organism-specific databases

    MIMi606856. phenotype.
    PharmGKBiPA142671205.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 13831383PalladinPRO_0000302720Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi292 ↔ 344PROSITE-ProRule annotation
    Modified residuei401 – 4011Phosphoserine4 Publications
    Disulfide bondi462 ↔ 521PROSITE-ProRule annotation
    Modified residuei684 – 6841Phosphoserine2 Publications
    Modified residuei688 – 6881Phosphoserine2 Publications
    Modified residuei893 – 8931Phosphoserine7 Publications
    Modified residuei979 – 9791Phosphoserine3 Publications
    Modified residuei984 – 9841Phosphoserine3 Publications
    Modified residuei1101 – 11011Phosphoserine2 Publications
    Modified residuei1104 – 11041Phosphoserine3 Publications
    Modified residuei1106 – 11061Phosphoserine2 Publications
    Modified residuei1116 – 11161Phosphoserine3 Publications
    Modified residuei1118 – 11181Phosphoserine; by PKB/AKT14 Publications
    Modified residuei1121 – 11211Phosphoserine4 Publications
    Disulfide bondi1156 ↔ 1208PROSITE-ProRule annotation

    Post-translational modificationi

    Phosphorylated predominantly on serines and, to a lesser extent, on tyrosines By similarity. Phosphorylation at Ser-1118 by PKB/AKT1 modulates cytoskeletal organization and cell motility.By similarity8 Publications

    Keywords - PTMi

    Disulfide bond, Phosphoprotein

    Proteomic databases

    MaxQBiQ8WX93.
    PaxDbiQ8WX93.
    PRIDEiQ8WX93.

    PTM databases

    PhosphoSiteiQ8WX93.

    Expressioni

    Tissue specificityi

    Detected in both muscle and non-muscle tissues. High expression in prostate, ovary, colon, and kidney. Not detected in spleen, skeletal muscle, lung and peripheral blood lymphocytes (at protein level). Protein is overexpressed in FA6, HPAF, IMIM-PC2, SUIT-2 and PancTu-II sporadic pancreatic cancer cell lines.1 Publication

    Inductioni

    Isoform 3 is expressed de novo. Isoform 4 is up-regulated by TGFB1 during myofibroblast differentiation.1 Publication

    Gene expression databases

    ArrayExpressiQ8WX93.
    BgeeiQ8WX93.
    GenevestigatoriQ8WX93.

    Interactioni

    Subunit structurei

    Interacts with EPS8, LASP1 and VASP By similarity. Interacts with ACTN, ARGBP2, LPP, PFN1, SPIN90, SRC and EZR.By similarity6 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SORBS2O948752EBI-2803991,EBI-311323

    Protein-protein interaction databases

    BioGridi116662. 13 interactions.
    IntActiQ8WX93. 5 interactions.

    Structurei

    Secondary structure

    1
    1383
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi1003 – 10053
    Beta strandi1010 – 10134
    Beta strandi1018 – 10247
    Beta strandi1031 – 10355
    Beta strandi1046 – 10527
    Beta strandi1057 – 10648
    Turni1067 – 10693
    Beta strandi1074 – 10785
    Beta strandi1084 – 10863
    Beta strandi1090 – 10934
    Beta strandi1136 – 11394
    Beta strandi1143 – 11508
    Beta strandi1155 – 11595
    Beta strandi1165 – 11673
    Beta strandi1169 – 11746
    Beta strandi1179 – 11857
    Beta strandi1191 – 11977
    Helixi1200 – 12023
    Beta strandi1204 – 12063
    Beta strandi1208 – 12114
    Beta strandi1216 – 12194
    Beta strandi1222 – 12265

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2DM2NMR-A1000-1096[»]
    2DM3NMR-A1133-1229[»]
    ProteinModelPortaliQ8WX93.
    SMRiQ8WX93. Positions 1000-1096, 1133-1230.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8WX93.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini271 – 36090Ig-like C2-type 1Add
    BLAST
    Domaini440 – 539100Ig-like C2-type 2Add
    BLAST
    Domaini1001 – 108585Ig-like C2-type 3Add
    BLAST
    Domaini1135 – 122692Ig-like C2-type 4Add
    BLAST
    Domaini1233 – 132492Ig-like C2-type 5Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni562 – 5665Interaction with VASPBy similarity
    Regioni646 – 67631Interaction with LASP1By similarityAdd
    BLAST
    Regioni676 – 69621Interaction with ARGBP2, SPIN90 and SRCAdd
    BLAST
    Regioni766 – 83166Interaction with EPS8By similarityAdd
    BLAST
    Regioni796 – 83136Interaction with ARGBP2, SPIN90, SRC and PFN1Add
    BLAST
    Regioni819 – 8235Interaction with VASPBy similarity
    Regioni833 – 89058Interaction with ACTNAdd
    BLAST
    Regioni1137 – 122690Interaction with EZRAdd
    BLAST
    Regioni1236 – 132691Interaction with EZRAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi563 – 5675Poly-Pro
    Compositional biasi634 – 864231Pro-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the myotilin/palladin family.Curated

    Keywords - Domaini

    Immunoglobulin domain, Repeat

    Phylogenomic databases

    eggNOGiNOG136920.
    HOGENOMiHOG000028074.
    HOVERGENiHBG059166.
    OMAiTPRVRWF.
    OrthoDBiEOG77WWBP.
    PhylomeDBiQ8WX93.
    TreeFamiTF343193.

    Family and domain databases

    Gene3Di2.60.40.10. 6 hits.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    [Graphical view]
    PfamiPF07679. I-set. 5 hits.
    [Graphical view]
    SMARTiSM00408. IGc2. 5 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 5 hits.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8WX93-1) [UniParc]FASTAAdd to Basket

    Also known as: 200-kDa

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSGTSSHESF YDSLSDMQEE SKNTDFFPGL SAFLSQEEIN KSLDLARRAI     50
    ADSETEDFDS EKEISQIFST SPASLCEHPS HKETKLGEHA SRRPQDNRST 100
    PVQPLAEKQT KSISSPVSKR KPAMSPLLTR PSYIRSLRKA EKRGAKTPST 150
    NVKPKTPHQR KGGPQSQLCD KAANLIEELT SIFKAAKPRN RSPNGESSSP 200
    DSGYLSPKNQ PSALLSASAS QSPMEDQGEM EREVKSPGAR HCYQDNQDLA 250
    VPHNRKSHPQ PHSALHFPAA PRFIQKLRSQ EVAEGSRVYL ECRVTGNPTP 300
    RVRWFCEGKE LHNTPDIQIH CEGGDLHTLI IAEAFEDDTG RYTCLATNPS 350
    GSDTTSAEVF IEGASSTDSD SESLAFKSRA GAMPQAQKKT TSVSLTIGSS 400
    SPKTGVTTAV IQPLSVPVQQ VHSPTSYLCR PDGTTTAYFP PVFTKELQNT 450
    AVAEGQVVVL ECRVRGAPPL QVQWFRQGSE IQDSPDFRIL QKKPRSTAEP 500
    EEICTLVIAE TFPEDAGIFT CSARNDYGSA TSTAQLVVTS ANTENCSYES 550
    MGESNNDHFQ HFPPPPPILE TSSLELASKK PSEIQQVNNP ELGLSRAALQ 600
    MQFNAAERET NGVHPSRGVN GLINGKANSN KSLPTPAVLL SPTKEPPPLL 650
    AKPKLDPLKL QQLQNQIRLE QEAGARQPPP APRSAPPSPP FPPPPAFPEL 700
    AACTPPASPE PMSALASRSA PAMQSSGSFN YARPKQFIAA QNLGPASGHG 750
    TPASSPSSSS LPSPMSPTPR QFGRAPVPPF AQPFGAEPEA PWGSSSPSPP 800
    PPPPPVFSPT AAFPVPDVFP LPPPPPPLPS PGQASHCSSP ATRFGHSQTP 850
    AAFLSALLPS QPPPAAVNAL GLPKGVTPAG FPKKASRTAR IASDEEIQGT 900
    KDAVIQDLER KLRFKEDLLN NGQPRLTYEE RMARRLLGAD SATVFNIQEP 950
    EEETANQEYK VSSCEQRLIS EIEYRLERSP VDESGDEVQY GDVPVENGMA 1000
    PFFEMKLKHY KIFEGMPVTF TCRVAGNPKP KIYWFKDGKQ ISPKSDHYTI 1050
    QRDLDGTCSL HTTASTLDDD GNYTIMAANP QGRISCTGRL MVQAVNQRGR 1100
    SPRSPSGHPH VRRPRSRSRD SGDENEPIQE RFFRPHFLQA PGDLTVQEGK 1150
    LCRMDCKVSG LPTPDLSWQL DGKPVRPDSA HKMLVRENGV HSLIIEPVTS 1200
    RDAGIYTCIA TNRAGQNSFS LELVVAAKEA HKPPVFIEKL QNTGVADGYP 1250
    VRLECRVLGV PPPQIFWKKE NESLTHSTDR VSMHQDNHGY ICLLIQGATK 1300
    EDAGWYTVSA KNEAGIVSCT ARLDVYTQWH QQSQSTKPKK VRPSASRYAA 1350
    LSDQGLDIKA AFQPEANPSH LTLNTALVES EDL 1383
    Length:1,383
    Mass (Da):150,564
    Last modified:November 30, 2010 - v3
    Checksum:i2CABAE1A6FEE855F
    GO
    Isoform 2 (identifier: Q8WX93-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         656-879: Missing.
         1326-1383: YTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL → YISRH

    Show »
    Length:1,106
    Mass (Da):122,047
    Checksum:i11CC06FA94B4758B
    GO
    Isoform 3 (identifier: Q8WX93-3) [UniParc]FASTAAdd to Basket

    Also known as: 140-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-382: Missing.

    Show »
    Length:1,001
    Mass (Da):108,632
    Checksum:iE1A3F96F80B40B4B
    GO
    Isoform 4 (identifier: Q8WX93-4) [UniParc]FASTAAdd to Basket

    Also known as: 90-kDa

    The sequence of this isoform differs from the canonical sequence as follows:
         1-711: Missing.

    Show »
    Length:672
    Mass (Da):73,322
    Checksum:i94168879EA796261
    GO
    Isoform 5 (identifier: Q8WX93-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         656-879: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,159
    Mass (Da):127,826
    Checksum:i0B1482F9B0C36C25
    GO
    Isoform 6 (identifier: Q8WX93-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         500-1383: PEEICTLVIA...NTALVESEDL → PDVLYVFVRVRCHQMKIQYYNLAHLISSWLSSFL

    Note: No experimental confirmation available.

    Show »
    Length:533
    Mass (Da):58,796
    Checksum:i608AB2AD12868576
    GO
    Isoform 7 (identifier: Q8WX93-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-998: Missing.

    Show »
    Length:385
    Mass (Da):42,933
    Checksum:i15853FB78B8E41B9
    GO
    Isoform 8 (identifier: Q8WX93-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-382: Missing.
         656-879: Missing.

    Show »
    Length:777
    Mass (Da):85,894
    Checksum:iD0EE5BAF3028E2BB
    GO
    Isoform 9 (identifier: Q8WX93-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         656-879: Missing.
         957-957: Q → QDIGSPHASVGSPLDGQK
         1327-1383: TQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL → ISRH

    Show »
    Length:1,123
    Mass (Da):123,693
    Checksum:i12D8DFEEBE3DF2B2
    GO

    Sequence cautioni

    The sequence AAO65174.1 differs from that shown. Reason: Frameshift at positions 1150 and 1154.
    The sequence AAD34146.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAA76836.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAC04796.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti277 – 2771L → P in BAC04796. (PubMed:14702039)Curated
    Sequence conflicti472 – 4721V → D in BAC04796. (PubMed:14702039)Curated
    Sequence conflicti611 – 6111N → S in AAL69964. 1 PublicationCurated
    Sequence conflicti847 – 8471S → G in BAA76836. (PubMed:10231032)Curated
    Sequence conflicti1126 – 11261E → D in AAO65174. (PubMed:12601173)Curated
    Sequence conflicti1146 – 11461V → G in AAO65174. (PubMed:12601173)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti224 – 2241M → I.
    Corresponds to variant rs7671781 [ dbSNP | Ensembl ].
    VAR_034940
    Natural varianti224 – 2241M → T.1 Publication
    Corresponds to variant rs7655494 [ dbSNP | Ensembl ].
    VAR_059401

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 998998Missing in isoform 7. 2 PublicationsVSP_027925Add
    BLAST
    Alternative sequencei1 – 711711Missing in isoform 4. 1 PublicationVSP_027926Add
    BLAST
    Alternative sequencei1 – 382382Missing in isoform 3 and isoform 8. 1 PublicationVSP_027927Add
    BLAST
    Alternative sequencei500 – 1383884PEEIC…ESEDL → PDVLYVFVRVRCHQMKIQYY NLAHLISSWLSSFL in isoform 6. 1 PublicationVSP_027928Add
    BLAST
    Alternative sequencei656 – 879224Missing in isoform 2, isoform 5, isoform 8 and isoform 9. 4 PublicationsVSP_027929Add
    BLAST
    Alternative sequencei957 – 9571Q → QDIGSPHASVGSPLDGQK in isoform 9. 1 PublicationVSP_043794
    Alternative sequencei1326 – 138358YTQWH…ESEDL → YISRH in isoform 2. 2 PublicationsVSP_027930Add
    BLAST
    Alternative sequencei1327 – 138357TQWHQ…ESEDL → ISRH in isoform 9. 1 PublicationVSP_043795Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF077041 mRNA. Translation: AAD27774.1.
    AF464873 mRNA. Translation: AAL69964.1.
    AB023209 mRNA. Translation: BAA76836.1. Different initiation.
    AF151909 mRNA. Translation: AAD34146.1. Different initiation.
    AK095512 mRNA. Translation: BAG53074.1.
    AK096458 mRNA. Translation: BAC04796.1. Different initiation.
    AC079858 Genomic DNA. No translation available.
    AC079926 Genomic DNA. No translation available.
    AC080188 Genomic DNA. No translation available.
    AC084353 Genomic DNA. No translation available.
    AC115538 Genomic DNA. No translation available.
    BC013867 mRNA. Translation: AAH13867.2.
    BC144666 mRNA. Translation: AAI44667.1.
    AY211921 mRNA. Translation: AAO65174.1. Frameshift.
    BX537391 mRNA. Translation: CAD97633.1.
    CCDSiCCDS34098.1. [Q8WX93-2]
    CCDS54818.1. [Q8WX93-9]
    CCDS54819.1. [Q8WX93-8]
    CCDS54820.1. [Q8WX93-4]
    PIRiT13078.
    RefSeqiNP_001159580.1. NM_001166108.1. [Q8WX93-9]
    NP_001159581.1. NM_001166109.1. [Q8WX93-8]
    NP_001159582.1. NM_001166110.1. [Q8WX93-4]
    NP_057165.3. NM_016081.3. [Q8WX93-2]
    XP_005262919.1. XM_005262862.2. [Q8WX93-1]
    UniGeneiHs.151220.

    Genome annotation databases

    EnsembliENST00000261509; ENSP00000261509; ENSG00000129116. [Q8WX93-2]
    ENST00000505667; ENSP00000425556; ENSG00000129116. [Q8WX93-9]
    ENST00000507735; ENSP00000424016; ENSG00000129116. [Q8WX93-4]
    ENST00000512127; ENSP00000426947; ENSG00000129116. [Q8WX93-8]
    GeneIDi23022.
    KEGGihsa:23022.
    UCSCiuc003irv.3. human. [Q8WX93-8]
    uc003irw.3. human. [Q8WX93-4]
    uc003irx.3. human. [Q8WX93-7]
    uc011cjx.2. human. [Q8WX93-9]

    Polymorphism databases

    DMDMi313104206.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF077041 mRNA. Translation: AAD27774.1 .
    AF464873 mRNA. Translation: AAL69964.1 .
    AB023209 mRNA. Translation: BAA76836.1 . Different initiation.
    AF151909 mRNA. Translation: AAD34146.1 . Different initiation.
    AK095512 mRNA. Translation: BAG53074.1 .
    AK096458 mRNA. Translation: BAC04796.1 . Different initiation.
    AC079858 Genomic DNA. No translation available.
    AC079926 Genomic DNA. No translation available.
    AC080188 Genomic DNA. No translation available.
    AC084353 Genomic DNA. No translation available.
    AC115538 Genomic DNA. No translation available.
    BC013867 mRNA. Translation: AAH13867.2 .
    BC144666 mRNA. Translation: AAI44667.1 .
    AY211921 mRNA. Translation: AAO65174.1 . Frameshift.
    BX537391 mRNA. Translation: CAD97633.1 .
    CCDSi CCDS34098.1. [Q8WX93-2 ]
    CCDS54818.1. [Q8WX93-9 ]
    CCDS54819.1. [Q8WX93-8 ]
    CCDS54820.1. [Q8WX93-4 ]
    PIRi T13078.
    RefSeqi NP_001159580.1. NM_001166108.1. [Q8WX93-9 ]
    NP_001159581.1. NM_001166109.1. [Q8WX93-8 ]
    NP_001159582.1. NM_001166110.1. [Q8WX93-4 ]
    NP_057165.3. NM_016081.3. [Q8WX93-2 ]
    XP_005262919.1. XM_005262862.2. [Q8WX93-1 ]
    UniGenei Hs.151220.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2DM2 NMR - A 1000-1096 [» ]
    2DM3 NMR - A 1133-1229 [» ]
    ProteinModelPortali Q8WX93.
    SMRi Q8WX93. Positions 1000-1096, 1133-1230.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116662. 13 interactions.
    IntActi Q8WX93. 5 interactions.

    Protein family/group databases

    MEROPSi I43.001.

    PTM databases

    PhosphoSitei Q8WX93.

    Polymorphism databases

    DMDMi 313104206.

    Proteomic databases

    MaxQBi Q8WX93.
    PaxDbi Q8WX93.
    PRIDEi Q8WX93.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261509 ; ENSP00000261509 ; ENSG00000129116 . [Q8WX93-2 ]
    ENST00000505667 ; ENSP00000425556 ; ENSG00000129116 . [Q8WX93-9 ]
    ENST00000507735 ; ENSP00000424016 ; ENSG00000129116 . [Q8WX93-4 ]
    ENST00000512127 ; ENSP00000426947 ; ENSG00000129116 . [Q8WX93-8 ]
    GeneIDi 23022.
    KEGGi hsa:23022.
    UCSCi uc003irv.3. human. [Q8WX93-8 ]
    uc003irw.3. human. [Q8WX93-4 ]
    uc003irx.3. human. [Q8WX93-7 ]
    uc011cjx.2. human. [Q8WX93-9 ]

    Organism-specific databases

    CTDi 23022.
    GeneCardsi GC04P169418.
    HGNCi HGNC:17068. PALLD.
    MIMi 606856. phenotype.
    608092. gene.
    neXtProti NX_Q8WX93.
    PharmGKBi PA142671205.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG136920.
    HOGENOMi HOG000028074.
    HOVERGENi HBG059166.
    OMAi TPRVRWF.
    OrthoDBi EOG77WWBP.
    PhylomeDBi Q8WX93.
    TreeFami TF343193.

    Miscellaneous databases

    ChiTaRSi PALLD. human.
    EvolutionaryTracei Q8WX93.
    GeneWikii Palladin.
    GenomeRNAii 23022.
    NextBioi 43970.
    PROi Q8WX93.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8WX93.
    Bgeei Q8WX93.
    Genevestigatori Q8WX93.

    Family and domain databases

    Gene3Di 2.60.40.10. 6 hits.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    [Graphical view ]
    Pfami PF07679. I-set. 5 hits.
    [Graphical view ]
    SMARTi SM00408. IGc2. 5 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Human SIH002 gene."
      Liu T., Zhang J., Ye M., Zhang Q., Fu G., Zhou J., Wu J., Shen Y., Yu M., Chen S., Mao M., Chen Z.
      Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
    2. Lockwood S.K.
      Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    3. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Brain.
    4. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
      Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
      Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 22-1383 (ISOFORM 6), VARIANT THR-224.
      Tissue: Tongue.
    6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 874-1383 (ISOFORM 1).
      Tissue: Placenta.
    8. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 874-1160 (ISOFORM 1).
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1188-1383 (ISOFORM 2).
      Tissue: Heart.
    10. "Characterization of human palladin, a microfilament-associated protein."
      Mykkaenen O.-M., Groenholm M., Roenty M., Lalowski M., Salmikangas P., Suila H., Carpen O.
      Mol. Biol. Cell 12:3060-3073(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH EZR, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    11. "Molecular analysis of the interaction between palladin and alpha-actinin."
      Roenty M., Taivainen A., Moza M., Otey C.A., Carpen O.
      FEBS Lett. 566:30-34(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ACTN.
    12. "Involvement of palladin and alpha-actinin in targeting of the Abl/Arg kinase adaptor ArgBP2 to the actin cytoskeleton."
      Roenty M., Taivainen A., Moza M., Kruh G.D., Ehler E., Carpen O.
      Exp. Cell Res. 310:88-98(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ARGBP2, SUBCELLULAR LOCATION.
    13. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-893 AND SER-1121, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. Cited for: INTERACTION WITH PFN1.
    15. "Isoform-specific regulation of the actin-organizing protein Palladin during TGF-beta1-induced myofibroblast differentiation."
      Roenty M.J., Leivonen S.-K., Hinz B., Rachlin A., Otey C.A., Kaehaeri V.-M., Carpen O.M.
      J. Invest. Dermatol. 126:2387-2396(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION (ISOFORMS 3 AND 4), INDUCTION.
    16. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-401 AND SER-893, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    17. "Angiotensin II, focal adhesion kinase, and PRX1 enhance smooth muscle expression of lipoma preferred partner and its newly identified binding partner palladin to promote cell migration."
      Jin L., Kern M.J., Otey C.A., Wamhoff B.R., Somlyo A.V.
      Circ. Res. 100:817-825(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH LPP, SUBCELLULAR LOCATION.
    18. "Palladin interacts with SH3 domains of SPIN90 and Src and is required for Src-induced cytoskeletal remodeling."
      Ronty M., Taivainen A., Heiska L., Otey C., Ehler E., Song W.K., Carpen O.
      Exp. Cell Res. 313:2575-2585(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH AND SRC, SUBCELLULAR LOCATION, PHOSPHORYLATION.
    19. Cited for: INVOLVEMENT IN PNCA1.
    20. Cited for: ASSOCIATION WITH MYOCARDIAL INFARCTION.
    21. "The P239S palladin variant does not account for a significant fraction of hereditary or early onset pancreas cancer."
      Zogopoulous G., Rothenmund H., Eppel A., Ash C., Akbari M.R., Hedley D., Narod S.A., Gallinger S.
      Hum. Genet. 121:635-637(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN PNCA1.
    22. "Palladin mutation causes familial pancreatic cancer: absence in European families."
      Slater E., Amrillaeva V., Fendrich V., Bartsch D., Earl J., Vitone L.J., Neoptolemos J.P., Greenhalf W.
      PLoS Med. 4:774-775(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: QUESTIONING OF INVOLVEMENT IN PNCA1.
    23. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-401; SER-893; SER-979 AND SER-984, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    24. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-893, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    25. "The actin-bundling protein palladin is an Akt1-specific substrate that regulates breast cancer cell migration."
      Chin Y.R., Toker A.
      Mol. Cell 38:333-344(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT SER-1118.
    26. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-401; SER-684; SER-688; SER-893; SER-979; SER-984; SER-1101; SER-1104; SER-1106; SER-1116; SER-1118 AND SER-1121, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    27. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    28. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-893; SER-1104; SER-1116; SER-1118 AND SER-1121, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    29. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    30. "Expression, crystallization and preliminary X-ray studies of the immunoglobulin-like domain 3 of human palladin."
      Liang W., Yang H., Xue X., Huang Q., Bartlam M., Chen S.
      Acta Crystallogr. F 62:556-558(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 1233-1324.
    31. "Solution structure of the first and second Ig domains of human palladin."
      RIKEN structural genomics initiative (RSGI)
      Submitted (APR-2007) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 1000-1230.

    Entry informationi

    Entry nameiPALLD_HUMAN
    AccessioniPrimary (citable) accession number: Q8WX93
    Secondary accession number(s): B3KTG2
    , B5MD56, B7ZMM5, Q7L3E0, Q7Z3W0, Q86WE8, Q8N1M2, Q9UGA0, Q9UQF5, Q9Y2J6, Q9Y3E9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: November 30, 2010
    Last modified: October 1, 2014
    This is version 120 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3