Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Palladin

Gene

PALLD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytoskeletal protein required for organization of normal actin cytoskeleton. Roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. May function as a scaffolding molecule with the potential to influence both actin polymerization and the assembly of existing actin filaments into higher-order arrays. Binds to proteins that bind to either monomeric or filamentous actin. Localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Different isoforms may have functional differences. Involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation. Involved in targeting ACTN to specific subcellular foci.3 Publications

GO - Molecular functioni

  • muscle alpha-actinin binding Source: HGNC

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

SIGNORiQ8WX93.

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Palladin
Alternative name(s):
SIH002
Sarcoma antigen NY-SAR-77
Gene namesi
Name:PALLD
Synonyms:KIAA0992
ORF Names:CGI-151
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:17068. PALLD.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: HPA
  • actin filament Source: HGNC
  • axon Source: UniProtKB-SubCell
  • cytoplasm Source: HPA
  • focal adhesion Source: UniProtKB
  • growth cone Source: UniProtKB-SubCell
  • lamellipodium Source: UniProtKB-SubCell
  • mitochondrion Source: HPA
  • nucleus Source: HGNC
  • plasma membrane Source: HPA
  • podosome Source: UniProtKB-SubCell
  • ruffle Source: UniProtKB-SubCell
  • Z disc Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Involvement in diseasei

Pancreatic cancer 1 (PNCA1)2 Publications
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA malignant neoplasm of the pancreas. Tumors can arise from both the exocrine and endocrine portions of the pancreas, but 95% of them develop from the exocrine portion, including the ductal epithelium, acinar cells, connective tissue, and lymphatic tissue.
See also OMIM:606856

Genetic variations in PALLD may be associated with susceptibility to myocardial infarction.

Organism-specific databases

DisGeNETi23022.
MalaCardsiPALLD.
MIMi606856. phenotype.
OpenTargetsiENSG00000129116.
PharmGKBiPA142671205.

Polymorphism and mutation databases

BioMutaiPALLD.
DMDMi313104206.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003027201 – 1383PalladinAdd BLAST1383

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei192PhosphoserineBy similarity1
Disulfide bondi292 ↔ 344PROSITE-ProRule annotation
Modified residuei401PhosphoserineCombined sources1
Disulfide bondi462 ↔ 521PROSITE-ProRule annotation
Modified residuei632PhosphoserineBy similarity1
Modified residuei635PhosphothreonineBy similarity1
Modified residuei641PhosphoserineCombined sources1
Modified residuei684PhosphoserineCombined sources1
Modified residuei688PhosphoserineCombined sources1
Modified residuei728PhosphoserineCombined sources1
Modified residuei893PhosphoserineCombined sources1
Modified residuei979PhosphoserineCombined sources1
Modified residuei984PhosphoserineCombined sources1
Modified residuei1101PhosphoserineCombined sources1
Modified residuei1104PhosphoserineCombined sources1
Modified residuei1106PhosphoserineCombined sources1
Modified residuei1116PhosphoserineCombined sources1
Modified residuei1118Phosphoserine; by PKB/AKT1Combined sources1 Publication1
Modified residuei1121PhosphoserineCombined sources1
Disulfide bondi1156 ↔ 1208PROSITE-ProRule annotation
Modified residuei1352PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated predominantly on serines and, to a lesser extent, on tyrosines (By similarity). Phosphorylation at Ser-1118 by PKB/AKT1 modulates cytoskeletal organization and cell motility.By similarity2 Publications

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

EPDiQ8WX93.
MaxQBiQ8WX93.
PaxDbiQ8WX93.
PeptideAtlasiQ8WX93.
PRIDEiQ8WX93.

PTM databases

iPTMnetiQ8WX93.
PhosphoSitePlusiQ8WX93.

Expressioni

Tissue specificityi

Detected in both muscle and non-muscle tissues. High expression in prostate, ovary, colon, and kidney. Not detected in spleen, skeletal muscle, lung and peripheral blood lymphocytes (at protein level). Protein is overexpressed in FA6, HPAF, IMIM-PC2, SUIT-2 and PancTu-II sporadic pancreatic cancer cell lines.1 Publication

Inductioni

Isoform 3 is expressed de novo. Isoform 4 is up-regulated by TGFB1 during myofibroblast differentiation.1 Publication

Gene expression databases

BgeeiENSG00000129116.
ExpressionAtlasiQ8WX93. baseline and differential.
GenevisibleiQ8WX93. HS.

Organism-specific databases

HPAiHPA035905.

Interactioni

Subunit structurei

Interacts with EPS8, LASP1 and VASP (By similarity). Interacts with ACTN, ARGBP2, LPP, PFN1, SPIN90, SRC and EZR.By similarity6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SORBS2O948752EBI-2803991,EBI-311323

GO - Molecular functioni

  • muscle alpha-actinin binding Source: HGNC

Protein-protein interaction databases

BioGridi116662. 46 interactors.
IntActiQ8WX93. 32 interactors.
STRINGi9606.ENSP00000425556.

Structurei

Secondary structure

11383
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi1003 – 1005Combined sources3
Beta strandi1010 – 1013Combined sources4
Beta strandi1018 – 1024Combined sources7
Beta strandi1031 – 1035Combined sources5
Beta strandi1046 – 1052Combined sources7
Beta strandi1057 – 1064Combined sources8
Turni1067 – 1069Combined sources3
Beta strandi1074 – 1078Combined sources5
Beta strandi1084 – 1086Combined sources3
Beta strandi1090 – 1093Combined sources4
Beta strandi1136 – 1139Combined sources4
Beta strandi1143 – 1150Combined sources8
Beta strandi1155 – 1159Combined sources5
Beta strandi1165 – 1167Combined sources3
Beta strandi1169 – 1174Combined sources6
Beta strandi1179 – 1185Combined sources7
Beta strandi1191 – 1197Combined sources7
Helixi1200 – 1202Combined sources3
Beta strandi1204 – 1206Combined sources3
Beta strandi1208 – 1211Combined sources4
Beta strandi1216 – 1219Combined sources4
Beta strandi1222 – 1226Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DM2NMR-A1000-1096[»]
2DM3NMR-A1133-1229[»]
ProteinModelPortaliQ8WX93.
SMRiQ8WX93.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WX93.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini271 – 360Ig-like C2-type 1Add BLAST90
Domaini440 – 539Ig-like C2-type 2Add BLAST100
Domaini1001 – 1085Ig-like C2-type 3Add BLAST85
Domaini1135 – 1226Ig-like C2-type 4Add BLAST92
Domaini1233 – 1324Ig-like C2-type 5Add BLAST92

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni562 – 566Interaction with VASPBy similarity5
Regioni646 – 676Interaction with LASP1By similarityAdd BLAST31
Regioni676 – 696Interaction with ARGBP2, SPIN90 and SRC1 PublicationAdd BLAST21
Regioni766 – 831Interaction with EPS8By similarityAdd BLAST66
Regioni796 – 831Interaction with ARGBP2, SPIN90, SRC and PFN12 PublicationsAdd BLAST36
Regioni819 – 823Interaction with VASPBy similarity5
Regioni833 – 890Interaction with ACTN1 PublicationAdd BLAST58
Regioni1137 – 1226Interaction with EZR1 PublicationAdd BLAST90
Regioni1236 – 1326Interaction with EZR1 PublicationAdd BLAST91

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi563 – 567Poly-Pro5
Compositional biasi634 – 864Pro-richAdd BLAST231

Sequence similaritiesi

Belongs to the myotilin/palladin family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat

Phylogenomic databases

eggNOGiENOG410IGH0. Eukaryota.
ENOG41103YT. LUCA.
GeneTreeiENSGT00840000129779.
HOGENOMiHOG000028074.
HOVERGENiHBG059166.
InParanoidiQ8WX93.
OMAiTPRVRWF.
OrthoDBiEOG091G011D.
PhylomeDBiQ8WX93.
TreeFamiTF343193.

Family and domain databases

Gene3Di2.60.40.10. 6 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR033017. Palladin.
[Graphical view]
PANTHERiPTHR10489:SF741. PTHR10489:SF741. 2 hits.
PfamiPF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
PROSITEiPS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WX93-1) [UniParc]FASTAAdd to basket
Also known as: 200-kDa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGTSSHESF YDSLSDMQEE SKNTDFFPGL SAFLSQEEIN KSLDLARRAI
60 70 80 90 100
ADSETEDFDS EKEISQIFST SPASLCEHPS HKETKLGEHA SRRPQDNRST
110 120 130 140 150
PVQPLAEKQT KSISSPVSKR KPAMSPLLTR PSYIRSLRKA EKRGAKTPST
160 170 180 190 200
NVKPKTPHQR KGGPQSQLCD KAANLIEELT SIFKAAKPRN RSPNGESSSP
210 220 230 240 250
DSGYLSPKNQ PSALLSASAS QSPMEDQGEM EREVKSPGAR HCYQDNQDLA
260 270 280 290 300
VPHNRKSHPQ PHSALHFPAA PRFIQKLRSQ EVAEGSRVYL ECRVTGNPTP
310 320 330 340 350
RVRWFCEGKE LHNTPDIQIH CEGGDLHTLI IAEAFEDDTG RYTCLATNPS
360 370 380 390 400
GSDTTSAEVF IEGASSTDSD SESLAFKSRA GAMPQAQKKT TSVSLTIGSS
410 420 430 440 450
SPKTGVTTAV IQPLSVPVQQ VHSPTSYLCR PDGTTTAYFP PVFTKELQNT
460 470 480 490 500
AVAEGQVVVL ECRVRGAPPL QVQWFRQGSE IQDSPDFRIL QKKPRSTAEP
510 520 530 540 550
EEICTLVIAE TFPEDAGIFT CSARNDYGSA TSTAQLVVTS ANTENCSYES
560 570 580 590 600
MGESNNDHFQ HFPPPPPILE TSSLELASKK PSEIQQVNNP ELGLSRAALQ
610 620 630 640 650
MQFNAAERET NGVHPSRGVN GLINGKANSN KSLPTPAVLL SPTKEPPPLL
660 670 680 690 700
AKPKLDPLKL QQLQNQIRLE QEAGARQPPP APRSAPPSPP FPPPPAFPEL
710 720 730 740 750
AACTPPASPE PMSALASRSA PAMQSSGSFN YARPKQFIAA QNLGPASGHG
760 770 780 790 800
TPASSPSSSS LPSPMSPTPR QFGRAPVPPF AQPFGAEPEA PWGSSSPSPP
810 820 830 840 850
PPPPPVFSPT AAFPVPDVFP LPPPPPPLPS PGQASHCSSP ATRFGHSQTP
860 870 880 890 900
AAFLSALLPS QPPPAAVNAL GLPKGVTPAG FPKKASRTAR IASDEEIQGT
910 920 930 940 950
KDAVIQDLER KLRFKEDLLN NGQPRLTYEE RMARRLLGAD SATVFNIQEP
960 970 980 990 1000
EEETANQEYK VSSCEQRLIS EIEYRLERSP VDESGDEVQY GDVPVENGMA
1010 1020 1030 1040 1050
PFFEMKLKHY KIFEGMPVTF TCRVAGNPKP KIYWFKDGKQ ISPKSDHYTI
1060 1070 1080 1090 1100
QRDLDGTCSL HTTASTLDDD GNYTIMAANP QGRISCTGRL MVQAVNQRGR
1110 1120 1130 1140 1150
SPRSPSGHPH VRRPRSRSRD SGDENEPIQE RFFRPHFLQA PGDLTVQEGK
1160 1170 1180 1190 1200
LCRMDCKVSG LPTPDLSWQL DGKPVRPDSA HKMLVRENGV HSLIIEPVTS
1210 1220 1230 1240 1250
RDAGIYTCIA TNRAGQNSFS LELVVAAKEA HKPPVFIEKL QNTGVADGYP
1260 1270 1280 1290 1300
VRLECRVLGV PPPQIFWKKE NESLTHSTDR VSMHQDNHGY ICLLIQGATK
1310 1320 1330 1340 1350
EDAGWYTVSA KNEAGIVSCT ARLDVYTQWH QQSQSTKPKK VRPSASRYAA
1360 1370 1380
LSDQGLDIKA AFQPEANPSH LTLNTALVES EDL
Length:1,383
Mass (Da):150,564
Last modified:November 30, 2010 - v3
Checksum:i2CABAE1A6FEE855F
GO
Isoform 2 (identifier: Q8WX93-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.
     1326-1383: YTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL → YISRH

Show »
Length:1,106
Mass (Da):122,047
Checksum:i11CC06FA94B4758B
GO
Isoform 3 (identifier: Q8WX93-3) [UniParc]FASTAAdd to basket
Also known as: 140-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-382: Missing.

Show »
Length:1,001
Mass (Da):108,632
Checksum:iE1A3F96F80B40B4B
GO
Isoform 4 (identifier: Q8WX93-4) [UniParc]FASTAAdd to basket
Also known as: 90-kDa

The sequence of this isoform differs from the canonical sequence as follows:
     1-711: Missing.

Show »
Length:672
Mass (Da):73,322
Checksum:i94168879EA796261
GO
Isoform 5 (identifier: Q8WX93-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.

Note: No experimental confirmation available.
Show »
Length:1,159
Mass (Da):127,826
Checksum:i0B1482F9B0C36C25
GO
Isoform 6 (identifier: Q8WX93-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     500-1383: PEEICTLVIA...NTALVESEDL → PDVLYVFVRVRCHQMKIQYYNLAHLISSWLSSFL

Note: No experimental confirmation available.
Show »
Length:533
Mass (Da):58,796
Checksum:i608AB2AD12868576
GO
Isoform 7 (identifier: Q8WX93-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-998: Missing.

Show »
Length:385
Mass (Da):42,933
Checksum:i15853FB78B8E41B9
GO
Isoform 8 (identifier: Q8WX93-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-382: Missing.
     656-879: Missing.

Show »
Length:777
Mass (Da):85,894
Checksum:iD0EE5BAF3028E2BB
GO
Isoform 9 (identifier: Q8WX93-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-879: Missing.
     957-957: Q → QDIGSPHASVGSPLDGQK
     1327-1383: TQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL → ISRH

Show »
Length:1,123
Mass (Da):123,693
Checksum:i12D8DFEEBE3DF2B2
GO

Sequence cautioni

The sequence AAD34146 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAO65174 differs from that shown. Reason: Frameshift at positions 1150 and 1154.Curated
The sequence BAA76836 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC04796 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti277L → P in BAC04796 (PubMed:14702039).Curated1
Sequence conflicti472V → D in BAC04796 (PubMed:14702039).Curated1
Sequence conflicti611N → S in AAL69964 (Ref. 2) Curated1
Sequence conflicti847S → G in BAA76836 (PubMed:10231032).Curated1
Sequence conflicti1126E → D in AAO65174 (PubMed:12601173).Curated1
Sequence conflicti1146V → G in AAO65174 (PubMed:12601173).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034940224M → I.Corresponds to variant rs7671781dbSNPEnsembl.1
Natural variantiVAR_059401224M → T.1 PublicationCorresponds to variant rs7655494dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0279251 – 998Missing in isoform 7. 2 PublicationsAdd BLAST998
Alternative sequenceiVSP_0279261 – 711Missing in isoform 4. 1 PublicationAdd BLAST711
Alternative sequenceiVSP_0279271 – 382Missing in isoform 3 and isoform 8. 1 PublicationAdd BLAST382
Alternative sequenceiVSP_027928500 – 1383PEEIC…ESEDL → PDVLYVFVRVRCHQMKIQYY NLAHLISSWLSSFL in isoform 6. 1 PublicationAdd BLAST884
Alternative sequenceiVSP_027929656 – 879Missing in isoform 2, isoform 5, isoform 8 and isoform 9. 4 PublicationsAdd BLAST224
Alternative sequenceiVSP_043794957Q → QDIGSPHASVGSPLDGQK in isoform 9. 1 Publication1
Alternative sequenceiVSP_0279301326 – 1383YTQWH…ESEDL → YISRH in isoform 2. 2 PublicationsAdd BLAST58
Alternative sequenceiVSP_0437951327 – 1383TQWHQ…ESEDL → ISRH in isoform 9. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF077041 mRNA. Translation: AAD27774.1.
AF464873 mRNA. Translation: AAL69964.1.
AB023209 mRNA. Translation: BAA76836.1. Different initiation.
AF151909 mRNA. Translation: AAD34146.1. Different initiation.
AK095512 mRNA. Translation: BAG53074.1.
AK096458 mRNA. Translation: BAC04796.1. Different initiation.
AC079858 Genomic DNA. No translation available.
AC079926 Genomic DNA. No translation available.
AC080188 Genomic DNA. No translation available.
AC084353 Genomic DNA. No translation available.
AC115538 Genomic DNA. No translation available.
BC013867 mRNA. Translation: AAH13867.2.
BC144666 mRNA. Translation: AAI44667.1.
AY211921 mRNA. Translation: AAO65174.1. Frameshift.
BX537391 mRNA. Translation: CAD97633.1.
CCDSiCCDS34098.1. [Q8WX93-2]
CCDS54818.1. [Q8WX93-9]
CCDS54819.1. [Q8WX93-8]
CCDS54820.1. [Q8WX93-4]
PIRiT13078.
RefSeqiNP_001159580.1. NM_001166108.1. [Q8WX93-9]
NP_001159581.1. NM_001166109.1. [Q8WX93-8]
NP_001159582.1. NM_001166110.1. [Q8WX93-4]
NP_057165.3. NM_016081.3. [Q8WX93-2]
UniGeneiHs.151220.

Genome annotation databases

EnsembliENST00000261509; ENSP00000261509; ENSG00000129116. [Q8WX93-2]
ENST00000505667; ENSP00000425556; ENSG00000129116. [Q8WX93-9]
ENST00000507735; ENSP00000424016; ENSG00000129116. [Q8WX93-4]
ENST00000512127; ENSP00000426947; ENSG00000129116. [Q8WX93-8]
GeneIDi23022.
KEGGihsa:23022.
UCSCiuc003iru.3. human. [Q8WX93-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF077041 mRNA. Translation: AAD27774.1.
AF464873 mRNA. Translation: AAL69964.1.
AB023209 mRNA. Translation: BAA76836.1. Different initiation.
AF151909 mRNA. Translation: AAD34146.1. Different initiation.
AK095512 mRNA. Translation: BAG53074.1.
AK096458 mRNA. Translation: BAC04796.1. Different initiation.
AC079858 Genomic DNA. No translation available.
AC079926 Genomic DNA. No translation available.
AC080188 Genomic DNA. No translation available.
AC084353 Genomic DNA. No translation available.
AC115538 Genomic DNA. No translation available.
BC013867 mRNA. Translation: AAH13867.2.
BC144666 mRNA. Translation: AAI44667.1.
AY211921 mRNA. Translation: AAO65174.1. Frameshift.
BX537391 mRNA. Translation: CAD97633.1.
CCDSiCCDS34098.1. [Q8WX93-2]
CCDS54818.1. [Q8WX93-9]
CCDS54819.1. [Q8WX93-8]
CCDS54820.1. [Q8WX93-4]
PIRiT13078.
RefSeqiNP_001159580.1. NM_001166108.1. [Q8WX93-9]
NP_001159581.1. NM_001166109.1. [Q8WX93-8]
NP_001159582.1. NM_001166110.1. [Q8WX93-4]
NP_057165.3. NM_016081.3. [Q8WX93-2]
UniGeneiHs.151220.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DM2NMR-A1000-1096[»]
2DM3NMR-A1133-1229[»]
ProteinModelPortaliQ8WX93.
SMRiQ8WX93.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116662. 46 interactors.
IntActiQ8WX93. 32 interactors.
STRINGi9606.ENSP00000425556.

Protein family/group databases

MEROPSiI43.001.

PTM databases

iPTMnetiQ8WX93.
PhosphoSitePlusiQ8WX93.

Polymorphism and mutation databases

BioMutaiPALLD.
DMDMi313104206.

Proteomic databases

EPDiQ8WX93.
MaxQBiQ8WX93.
PaxDbiQ8WX93.
PeptideAtlasiQ8WX93.
PRIDEiQ8WX93.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261509; ENSP00000261509; ENSG00000129116. [Q8WX93-2]
ENST00000505667; ENSP00000425556; ENSG00000129116. [Q8WX93-9]
ENST00000507735; ENSP00000424016; ENSG00000129116. [Q8WX93-4]
ENST00000512127; ENSP00000426947; ENSG00000129116. [Q8WX93-8]
GeneIDi23022.
KEGGihsa:23022.
UCSCiuc003iru.3. human. [Q8WX93-1]

Organism-specific databases

CTDi23022.
DisGeNETi23022.
GeneCardsiPALLD.
HGNCiHGNC:17068. PALLD.
HPAiHPA035905.
MalaCardsiPALLD.
MIMi606856. phenotype.
608092. gene.
neXtProtiNX_Q8WX93.
OpenTargetsiENSG00000129116.
PharmGKBiPA142671205.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGH0. Eukaryota.
ENOG41103YT. LUCA.
GeneTreeiENSGT00840000129779.
HOGENOMiHOG000028074.
HOVERGENiHBG059166.
InParanoidiQ8WX93.
OMAiTPRVRWF.
OrthoDBiEOG091G011D.
PhylomeDBiQ8WX93.
TreeFamiTF343193.

Enzyme and pathway databases

SIGNORiQ8WX93.

Miscellaneous databases

ChiTaRSiPALLD. human.
EvolutionaryTraceiQ8WX93.
GeneWikiiPalladin.
GenomeRNAii23022.
PROiQ8WX93.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129116.
ExpressionAtlasiQ8WX93. baseline and differential.
GenevisibleiQ8WX93. HS.

Family and domain databases

Gene3Di2.60.40.10. 6 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR033017. Palladin.
[Graphical view]
PANTHERiPTHR10489:SF741. PTHR10489:SF741. 2 hits.
PfamiPF07679. I-set. 5 hits.
[Graphical view]
SMARTiSM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
PROSITEiPS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPALLD_HUMAN
AccessioniPrimary (citable) accession number: Q8WX93
Secondary accession number(s): B3KTG2
, B5MD56, B7ZMM5, Q7L3E0, Q7Z3W0, Q86WE8, Q8N1M2, Q9UGA0, Q9UQF5, Q9Y2J6, Q9Y3E9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: November 30, 2010
Last modified: November 30, 2016
This is version 143 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Was wrongly assigned as myoneurin (Ref. 2).Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.