Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-1 family member 10

Gene

IL1F10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-1 family member 10
Short name:
IL-1F10
Alternative name(s):
Family of interleukin 1-theta
Short name:
FIL1 theta
Interleukin-1 HY2
Short name:
IL-1HY2
Interleukin-1 theta
Short name:
IL-1 theta
Interleukin-38
Short name:
IL-38
Gene namesi
Name:IL1F10
Synonyms:FIL1T, IL1HY2, IL38
ORF Names:FKSG75, UNQ6119/PRO20041
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:15552. IL1F10.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38387.

Polymorphism and mutation databases

BioMutaiIL1F10.
DMDMi25008589.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 152152Interleukin-1 family member 10PRO_0000153650Add
BLAST

Proteomic databases

PaxDbiQ8WWZ1.
PeptideAtlasiQ8WWZ1.
PRIDEiQ8WWZ1.

PTM databases

iPTMnetiQ8WWZ1.

Expressioni

Tissue specificityi

Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.

Gene expression databases

BgeeiQ8WWZ1.
CleanExiHS_IL1F10.
GenevisibleiQ8WWZ1. HS.

Organism-specific databases

HPAiHPA059813.

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi124164. 1 interaction.
STRINGi9606.ENSP00000341794.

Structurei

3D structure databases

ProteinModelPortaliQ8WWZ1.
SMRiQ8WWZ1. Positions 18-150.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-1 family.Curated

Phylogenomic databases

eggNOGiENOG410IWY5. Eukaryota.
ENOG41118N6. LUCA.
GeneTreeiENSGT00530000062899.
HOGENOMiHOG000231506.
HOVERGENiHBG052099.
InParanoidiQ8WWZ1.
KOiK05488.
OMAiAAWPGWF.
OrthoDBiEOG747PKM.
PhylomeDBiQ8WWZ1.
TreeFamiTF300203.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR027164. IL-1_F10.
IPR000975. IL-1_fam.
IPR003297. IL-1RA/IL-36.
[Graphical view]
PANTHERiPTHR10078:SF8. PTHR10078:SF8. 1 hit.
PfamiPF00340. IL1. 1 hit.
[Graphical view]
PRINTSiPR00264. INTERLEUKIN1.
PR01360. INTRLEUKIN1X.
SUPFAMiSSF50353. SSF50353. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WWZ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCSLPMARYY IIKYADQKAL YTRDGQLLVG DPVADNCCAE KICILPNRGL
60 70 80 90 100
ARTKVPIFLG IQGGSRCLAC VETEEGPSLQ LEDVNIEELY KGGEEATRFT
110 120 130 140 150
FFQSSSGSAF RLEAAAWPGW FLCGPAEPQQ PVQLTKESEP SARTKFYFEQ

SW
Length:152
Mass (Da):16,943
Last modified:March 1, 2002 - v1
Checksum:iE0ABD2496551B34F
GO
Isoform 2 (identifier: Q8WWZ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     9-39: YYIIKYADQKALYTRDGQLLVGDPVADNCCA → MSSSFLPEPLPAKSLQHGVPLSLDSSLSSLL

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):16,701
Checksum:i8473E8E2FC64ACCC
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti44 – 441I → T.4 Publications
Corresponds to variant rs6761276 [ dbSNP | Ensembl ].
VAR_014262
Natural varianti51 – 511A → D.4 Publications
Corresponds to variant rs6743376 [ dbSNP | Ensembl ].
VAR_014263

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei9 – 3931YYIIK…DNCCA → MSSSFLPEPLPAKSLQHGVP LSLDSSLSSLL in isoform 2. 1 PublicationVSP_002658Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029413 mRNA. Translation: AAK33010.1.
AY026753 mRNA. Translation: AAK01948.1.
AF334755 mRNA. Translation: AAK68048.1.
AF334756 Genomic DNA. Translation: AAK68049.1.
BN000002 Genomic DNA. Translation: CAD29878.1.
AY358846 mRNA. Translation: AAQ89205.1.
AY972854 Genomic DNA. Translation: AAX59032.1.
AC016724 Genomic DNA. Translation: AAY14991.1.
BC103966 mRNA. Translation: AAI03967.1.
BC103967 mRNA. Translation: AAI03968.1.
BC103968 mRNA. Translation: AAI03969.1.
CCDSiCCDS2112.1. [Q8WWZ1-1]
RefSeqiNP_115945.4. NM_032556.5. [Q8WWZ1-1]
NP_775184.1. NM_173161.2. [Q8WWZ1-1]
UniGeneiHs.306974.

Genome annotation databases

EnsembliENST00000341010; ENSP00000341794; ENSG00000136697. [Q8WWZ1-1]
ENST00000393197; ENSP00000376893; ENSG00000136697. [Q8WWZ1-1]
GeneIDi84639.
KEGGihsa:84639.
UCSCiuc002tiu.4. human. [Q8WWZ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Interleukin-1 entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029413 mRNA. Translation: AAK33010.1.
AY026753 mRNA. Translation: AAK01948.1.
AF334755 mRNA. Translation: AAK68048.1.
AF334756 Genomic DNA. Translation: AAK68049.1.
BN000002 Genomic DNA. Translation: CAD29878.1.
AY358846 mRNA. Translation: AAQ89205.1.
AY972854 Genomic DNA. Translation: AAX59032.1.
AC016724 Genomic DNA. Translation: AAY14991.1.
BC103966 mRNA. Translation: AAI03967.1.
BC103967 mRNA. Translation: AAI03968.1.
BC103968 mRNA. Translation: AAI03969.1.
CCDSiCCDS2112.1. [Q8WWZ1-1]
RefSeqiNP_115945.4. NM_032556.5. [Q8WWZ1-1]
NP_775184.1. NM_173161.2. [Q8WWZ1-1]
UniGeneiHs.306974.

3D structure databases

ProteinModelPortaliQ8WWZ1.
SMRiQ8WWZ1. Positions 18-150.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124164. 1 interaction.
STRINGi9606.ENSP00000341794.

PTM databases

iPTMnetiQ8WWZ1.

Polymorphism and mutation databases

BioMutaiIL1F10.
DMDMi25008589.

Proteomic databases

PaxDbiQ8WWZ1.
PeptideAtlasiQ8WWZ1.
PRIDEiQ8WWZ1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341010; ENSP00000341794; ENSG00000136697. [Q8WWZ1-1]
ENST00000393197; ENSP00000376893; ENSG00000136697. [Q8WWZ1-1]
GeneIDi84639.
KEGGihsa:84639.
UCSCiuc002tiu.4. human. [Q8WWZ1-1]

Organism-specific databases

CTDi84639.
GeneCardsiIL1F10.
HGNCiHGNC:15552. IL1F10.
HPAiHPA059813.
MIMi615296. gene.
neXtProtiNX_Q8WWZ1.
PharmGKBiPA38387.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWY5. Eukaryota.
ENOG41118N6. LUCA.
GeneTreeiENSGT00530000062899.
HOGENOMiHOG000231506.
HOVERGENiHBG052099.
InParanoidiQ8WWZ1.
KOiK05488.
OMAiAAWPGWF.
OrthoDBiEOG747PKM.
PhylomeDBiQ8WWZ1.
TreeFamiTF300203.

Miscellaneous databases

GeneWikiiIL1F10.
GenomeRNAii84639.
PROiQ8WWZ1.
SOURCEiSearch...

Gene expression databases

BgeeiQ8WWZ1.
CleanExiHS_IL1F10.
GenevisibleiQ8WWZ1. HS.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR027164. IL-1_F10.
IPR000975. IL-1_fam.
IPR003297. IL-1RA/IL-36.
[Graphical view]
PANTHERiPTHR10078:SF8. PTHR10078:SF8. 1 hit.
PfamiPF00340. IL1. 1 hit.
[Graphical view]
PRINTSiPR00264. INTERLEUKIN1.
PR01360. INTRLEUKIN1X.
SUPFAMiSSF50353. SSF50353. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel human cytokine gene in the interleukin gene cluster on chromosome 2q12-14."
    Bensen J.T., Dawson P.A., Mychaleckyj J.C., Bowden D.W.
    J. Interferon Cytokine Res. 21:899-904(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Thymus.
  2. "Identification and characterization of FKSG75, a novel member of the interleukin-1 family."
    Wang Y.-G., Li T., Gong L.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANTS THR-44 AND ASP-51.
    Tissue: Fetal skin.
  4. "A sequence-based map of the nine genes of the human interleukin-1 cluster."
    Nicklin M.J.H., Barton J.L., Nguyen M., Fitzgerald M.G., Duff W.G., Kornman K.
    Genomics 79:718-725(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. SeattleSNPs variation discovery resource
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS THR-44 AND ASP-51.
  7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], VARIANTS THR-44 AND ASP-51.
  9. "IL-38 binds to the IL-36 receptor and has biological effects on immune cells similar to IL-36 receptor antagonist."
    van de Veerdonk F.L., Stoeckman A.K., Wu G., Boeckermann A.N., Azam T., Netea M.G., Joosten L.A., van der Meer J.W., Hao R., Kalabokis V., Dinarello C.A.
    Proc. Natl. Acad. Sci. U.S.A. 109:3001-3005(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  10. Cited for: VARIANTS THR-44 AND ASP-51.

Entry informationi

Entry nameiIL1FA_HUMAN
AccessioniPrimary (citable) accession number: Q8WWZ1
Secondary accession number(s): Q53SR9
, Q56AT8, Q7RTZ5, Q969H5, Q9BYX1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: March 1, 2002
Last modified: June 8, 2016
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.