Q8WWY3 (PRP31_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: U4/U6 small nuclear ribonucleoprotein Prp31 Alternative name(s): Pre-mRNA-processing factor 31 Serologically defined breast cancer antigen NY-BR-99 U4/U6 snRNP 61 kDa protein Short name=Protein 61K Short name=hPrp31 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 499 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in pre-mRNA splicing. Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. Ref.1 |
| Subunit structure | Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39. Interacts with a complex formed by NHP2L1 and U4 snRNA, but not with NHP2L1 or U4 snRNA alone. Interacts with PRPF6/U5 snRNP-associated 102 kDa protein. Component of some MLL1/MLL complex, at least composed of the core components MLL, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts (via its NLS) with CTNNBL1. Ref.1 Ref.7 Ref.8 Ref.13 Ref.14 |
| Subcellular location | Nucleus speckle. Nucleus › Cajal body. Note: Predominantly found in speckles and in Cajal bodies. Ref.1 Ref.17 |
| Tissue specificity | Ubiquitously expressed. Ref.16 |
| Domain | Interacts with the snRNP via the Nop domain. Ref.14 The coiled coil domain is formed by two non-contiguous helices. Ref.14 |
| Involvement in disease | Retinitis pigmentosa 11 (RP11) [MIM:600138]: A retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. |
| Sequence similarities | Belongs to the PRP31 family. Contains 1 Nop domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WWY3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WWY3-2) The sequence of this isoform differs from the canonical sequence as follows: 333-364: EPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKE → RRRWLRPTRSISPAWLSSSRSRARRVALCPPE 365-499: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8WWY3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-80: Missing. 359-499: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 499 | 499 | U4/U6 small nuclear ribonucleoprotein Prp31 | PRO_0000227799 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Domain | 215 – 333 | 119 | Nop | ||||||||||||||||||||||||||||||||||||||
| Region | 351 – 364 | 14 | Nuclear localization signal (NLS) | ||||||||||||||||||||||||||||||||||||||
| Coiled coil | 85 – 120 | 36 | Ref.14 | ||||||||||||||||||||||||||||||||||||||
| Coiled coil | 181 – 215 | 35 | Ref.14 | ||||||||||||||||||||||||||||||||||||||
| Compositional bias | 16 – 19 | 4 | Poly-Glu | ||||||||||||||||||||||||||||||||||||||
| Compositional bias | 25 – 29 | 5 | Poly-Glu | ||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||
| Site | 247 | 1 | Interaction with U4 snRNA | ||||||||||||||||||||||||||||||||||||||
| Site | 270 | 1 | Interaction with U4 snRNA | ||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 379 | 1 | Phosphoserine Ref.10 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 450 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 455 | 1 | Phosphothreonine Ref.9 Ref.10 Ref.11 | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 80 | 80 | Missing in isoform 3. | VSP_017581 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 333 – 364 | 32 | EPPPV…RKMKE → RRRWLRPTRSISPAWLSSSR SRARRVALCPPE in isoform 2. | VSP_017582 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 359 – 499 | 141 | Missing in isoform 3. | VSP_017583 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 365 – 499 | 135 | Missing in isoform 2. | VSP_017584 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 111 – 114 | 4 | Missing in RP11; high penetrance. | VAR_025629 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 194 | 1 | A → E in RP11; mislocation of the protein in the cytoplasm and reduced interaction with PRPF6; the result may be a deficiency in splicing function in the retina. Ref.14 Ref.16 Ref.17 | VAR_025630 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 216 | 1 | A → P in RP11; mislocation of the protein in the cytoplasm, but no effect on interaction with PRPF6; the result may be a deficiency in splicing function in the retina. Ref.14 Ref.15 Ref.16 Ref.17 | VAR_025631 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 270 | 1 | H → A or K: Reduces binding to the complex formed by U4 snRNA and NHP2L1. Ref.14 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 351 – 364 | 14 | Missing: Abolishes nuclear localization. Ref.17 | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 188 | 1 | E → D in AAK77986. Ref.1 | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 235 | 1 | A → G in AAG48270. Ref.2 | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 244 | 1 | M → V in CAB43677. Ref.3 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Helix | 89 – 118 | 30 | |||||||||||||||||||||||||||||||||||||||
| Turn | 119 – 121 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 125 – 128 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 132 – 142 | 11 | |||||||||||||||||||||||||||||||||||||||
| Helix | 146 – 148 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 149 – 151 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 155 – 157 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 161 – 172 | 12 | |||||||||||||||||||||||||||||||||||||||
| Helix | 181 – 215 | 35 | |||||||||||||||||||||||||||||||||||||||
| Helix | 217 – 235 | 19 | |||||||||||||||||||||||||||||||||||||||
| Helix | 238 – 242 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 246 – 249 | 4 | |||||||||||||||||||||||||||||||||||||||
| Turn | 250 – 253 | 4 | |||||||||||||||||||||||||||||||||||||||
| Turn | 273 – 276 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 278 – 281 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 285 – 287 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 288 – 307 | 20 | |||||||||||||||||||||||||||||||||||||||
| Helix | 315 – 331 | 17 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Protein 61K, encoded by a gene (PRPF31) linked to autosomal dominant retinitis pigmentosa, is required for U4/U6.U5 tri-snRNP formation and pre-mRNA splicing." Makarova O.V., Makarov E.M., Liu S., Vornlocher H.-P., Luehrmann R. EMBO J. 21:1148-1157(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBUNIT, SUBCELLULAR LOCATION, FUNCTION, INTERACTION WITH C20ORF14. |
| [2] | "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression." Scanlan M.J., Gout I., Gordon C.M., Williamson B., Stockert E., Gure A.O., Jaeger D., Chen Y.-T., Mackay A., O'Hare M.J., Old L.J. Cancer Immun. 1:4-4(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Mammary gland. |
| [3] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [5] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [7] | "Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF." Dou Y., Milne T.A., Tackett A.J., Smith E.R., Fukuda A., Wysocka J., Allis C.D., Chait B.T., Hess J.L., Roeder R.G. Cell 121:873-885(2005) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE MLL1/MLL COMPLEX. |
| [8] | "The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP." Liu S., Rauhut R., Vornlocher H.-P., Luehrmann R. RNA 12:1418-1430(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-450 AND THR-455, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-379 AND THR-455, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-455, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "CTNNBL1 is a novel nuclear localization sequence-binding protein that recognizes RNA-splicing factors CDC5L and Prp31." Ganesh K., Adam S., Taylor B., Simpson P., Rada C., Neuberger M. J. Biol. Chem. 286:17091-17102(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CTNNBL1. |
| [14] | "Binding of the human Prp31 Nop domain to a composite RNA-protein platform in U4 snRNP." Liu S., Li P., Dybkov O., Nottrott S., Hartmuth K., Luehrmann R., Carlomagno T., Wahl M.C. Science 316:115-120(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 78-333 IN COMPLEX WITH NHP2L1 AND STEM-LOOP RNA OF U4 SNRNA, COILED-COIL DOMAIN, INTERACTION WITH PRPF6, CHARACTERIZATION OF VARIANTS RP11 GLU-194 AND PRO-216, MUTAGENESIS OF HIS-270. |
| [15] | "Evidence for a major retinitis pigmentosa locus on 19q13.4 (RP11) and association with a unique bimodal expressivity phenotype." Al-Maghtheh M., Vithana E., Tarttelin E., Jay M., Evans K., Moore T., Bhattacharya S., Inglehearn C.F. Am. J. Hum. Genet. 59:864-871(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT RP11 PRO-216. |
| [16] | "A human homolog of yeast pre-mRNA splicing gene, PRP31, underlies autosomal dominant retinitis pigmentosa on chromosome 19q13.4 (RP11)." Vithana E.N., Abu-Safieh L., Allen M.J., Carey A., Papaioannou M., Chakarova C., Al-Maghtheh M., Ebenezer N.D., Willis C., Moore A.T., Bird A.C., Hunt D.M., Bhattacharya S.S. Mol. Cell 8:375-381(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RP11 GLU-194 AND RP11 PRO-216, TISSUE SPECIFICITY. |
| [17] | "Disease mechanism for retinitis pigmentosa (RP11) caused by mutations in the splicing factor gene PRPF31." Deery E.C., Vithana E.N., Newbold R.J., Gallon V.A., Bhattacharya S.S., Warren M.J., Hunt D.M., Wilkie S.E. Hum. Mol. Genet. 11:3209-3219(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS RP11 GLU-194 AND PRO-216, SUBCELLULAR LOCATION, NUCLEAR LOCALIZATION SIGNAL, MUTAGENESIS OF 351-ARG--GLU-364. |
| [18] | "Novel deletion in the pre-mRNA splicing gene PRPF31 causes autosomal dominant retinitis pigmentosa in a large Chinese family." Wang L., Ribaudo M., Zhao K., Yu N., Chen Q., Sun Q., Wang L., Wang Q. Am. J. Med. Genet. A 121:235-239(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT RP11 111-HIS--ILE-114 DEL. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY040822 mRNA. Translation: AAK77986.1. AF308303 mRNA. Translation: AAG48270.1. AL050369 mRNA. Translation: CAB43677.1. AK098547 mRNA. Translation: BAC05329.1. AC012314 Genomic DNA. No translation available. BC117389 mRNA. Translation: AAI17390.1. | ||||||||||||||||||||||||
| IPI | IPI00167198. IPI00292000. IPI00738596. | ||||||||||||||||||||||||
| RefSeq | NP_056444.3. NM_015629.3. | ||||||||||||||||||||||||
| UniGene | Hs.515598. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q8WWY3. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q8WWY3. 11 interactions. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000324122. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q8WWY3. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 90101442. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q8WWY3. | ||||||||||||||||||||||||
| PRIDE | Q8WWY3. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 26121. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000321030; ENSP00000324122; ENSG00000105618. ENST00000574214; ENSP00000459844; ENSG00000268831. ENST00000594459; ENSP00000470434; ENSG00000268383. ENST00000594992; ENSP00000470951; ENSG00000268495. ENST00000595296; ENSP00000469212; ENSG00000269606. ENST00000596401; ENSP00000472824; ENSG00000269379. ENST00000598374; ENSP00000472567; ENSG00000268710. ENST00000598556; ENSP00000471591; ENSG00000269276. ENST00000599348; ENSP00000470497; ENSG00000267847. | ||||||||||||||||||||||||
| GeneID | 26121. | ||||||||||||||||||||||||
| KEGG | hsa:26121. | ||||||||||||||||||||||||
| UCSC | uc002qdh.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 26121. | ||||||||||||||||||||||||
| GeneCards | GC19P054618. | ||||||||||||||||||||||||
| H-InvDB | HIX0027609. HIX0137464. | ||||||||||||||||||||||||
| HGNC | HGNC:15446. PRPF31. | ||||||||||||||||||||||||
| HPA | HPA041939. | ||||||||||||||||||||||||
| MIM | 600138. phenotype. 606419. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q8WWY3. | ||||||||||||||||||||||||
| Orphanet | 791. Retinitis pigmentosa. | ||||||||||||||||||||||||
| PharmGKB | PA33814. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG1498. | ||||||||||||||||||||||||
| HOGENOM | HOG000207983. | ||||||||||||||||||||||||
| HOVERGEN | HBG082193. | ||||||||||||||||||||||||
| InParanoid | Q8WWY3. | ||||||||||||||||||||||||
| KO | K12844. | ||||||||||||||||||||||||
| OMA | VESDPEY. | ||||||||||||||||||||||||
| OrthoDB | EOG4W6NW1. | ||||||||||||||||||||||||
| PhylomeDB | Q8WWY3. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q8WWY3. | ||||||||||||||||||||||||
| Bgee | Q8WWY3. | ||||||||||||||||||||||||
| CleanEx | HS_PRPF31. | ||||||||||||||||||||||||
| Genevestigator | Q8WWY3. | ||||||||||||||||||||||||
| GermOnline | ENSG00000105618. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR002687. Nop_dom. IPR012976. NOSIC. IPR027105. Prp31. IPR019175. Prp31_C. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR13904. PTHR13904. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF01798. Nop. 1 hit. PF08060. NOSIC. 1 hit. PF09785. Prp31_C. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00931. NOSIC. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS51358. NOP. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| EvolutionaryTrace | Q8WWY3. | ||||||||||||||||||||||||
| GenomeRNAi | 26121. | ||||||||||||||||||||||||
| NextBio | 48131. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | PRP31_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WWY3 Secondary accession number(s): Q17RB4 Q9Y439 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
