Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

U4/U6 small nuclear ribonucleoprotein Prp31

Gene

PRPF31

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in pre-mRNA splicing. Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome.1 Publication

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
  • ribonucleoprotein complex binding Source: MGI
  • snRNP binding Source: BHF-UCL
  • U4atac snRNA binding Source: GO_Central
  • U4 snRNA binding Source: GO_Central

GO - Biological processi

  • mRNA splicing, via spliceosome Source: BHF-UCL
  • ribonucleoprotein complex localization Source: UniProtKB
  • spliceosomal tri-snRNP complex assembly Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein

Keywords - Biological processi

mRNA processing, mRNA splicing

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000105618-MONOMER.
ReactomeiR-HSA-72163. mRNA Splicing - Major Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
U4/U6 small nuclear ribonucleoprotein Prp31
Alternative name(s):
Pre-mRNA-processing factor 31
Serologically defined breast cancer antigen NY-BR-99
U4/U6 snRNP 61 kDa protein
Short name:
Protein 61K
Short name:
hPrp31
Gene namesi
Name:PRPF31
Synonyms:PRP31
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:15446. PRPF31.

Subcellular locationi

GO - Cellular componenti

  • Cajal body Source: MGI
  • MLL1 complex Source: UniProtKB
  • nuclear speck Source: MGI
  • nucleoplasm Source: Reactome
  • nucleus Source: LIFEdb
  • precatalytic spliceosome Source: GO_Central
  • U2-type spliceosomal complex Source: BHF-UCL
  • U4/U6 x U5 tri-snRNP complex Source: MGI
  • U4atac snRNP Source: BHF-UCL
  • U4 snRNP Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

Pathology & Biotechi

Involvement in diseasei

Retinitis pigmentosa 11 (RP11)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
See also OMIM:600138
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025629111 – 114Missing in RP11; high penetrance. 1 Publication4
Natural variantiVAR_025630194A → E in RP11; mislocation of the protein in the cytoplasm and reduced interaction with PRPF6; the result may be a deficiency in splicing function in the retina. 3 PublicationsCorresponds to variant rs119475043dbSNPEnsembl.1
Natural variantiVAR_025631216A → P in RP11; mislocation of the protein in the cytoplasm, but no effect on interaction with PRPF6; the result may be a deficiency in splicing function in the retina. 4 PublicationsCorresponds to variant rs119475042dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi270H → A or K: Reduces binding to the complex formed by U4 snRNA and SNU13. 1 Publication1
Mutagenesisi351 – 364Missing : Abolishes nuclear localization. 1 PublicationAdd BLAST14

Keywords - Diseasei

Disease mutation, Retinitis pigmentosa

Organism-specific databases

DisGeNETi26121.
MalaCardsiPRPF31.
MIMi600138. phenotype.
OpenTargetsiENSG00000105618.
ENSG00000274144.
ENSG00000274651.
ENSG00000274894.
ENSG00000275117.
ENSG00000275885.
ENSG00000276421.
ENSG00000277154.
ENSG00000277707.
ENSG00000277953.
Orphaneti791. Retinitis pigmentosa.
PharmGKBiPA33814.

Polymorphism and mutation databases

BioMutaiPRPF31.
DMDMi90101442.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002277991 – 499U4/U6 small nuclear ribonucleoprotein Prp31Add BLAST499

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei379PhosphoserineCombined sources1
Modified residuei395PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei438N6-acetyllysineBy similarity1
Modified residuei439PhosphoserineCombined sources1
Modified residuei440PhosphothreonineCombined sources1
Modified residuei450PhosphoserineCombined sources1
Modified residuei455PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8WWY3.
MaxQBiQ8WWY3.
PaxDbiQ8WWY3.
PeptideAtlasiQ8WWY3.
PRIDEiQ8WWY3.

PTM databases

iPTMnetiQ8WWY3.
PhosphoSitePlusiQ8WWY3.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000105618.
CleanExiHS_PRPF31.
ExpressionAtlasiQ8WWY3. baseline and differential.
GenevisibleiQ8WWY3. HS.

Organism-specific databases

HPAiHPA041939.
HPA061873.

Interactioni

Subunit structurei

Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39. Interacts with a complex formed by SNU13 and U4 snRNA, but not with SNU13 or U4 snRNA alone. Interacts with PRPF6/U5 snRNP-associated 102 kDa protein. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts (via its NLS) with CTNNBL1.5 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei247Interaction with U4 snRNA1
Sitei270Interaction with U4 snRNA1

Binary interactionsi

WithEntry#Exp.IntActNotes
AESQ08117-24EBI-1567797,EBI-11741437
CCNDBP1O952734EBI-1567797,EBI-748961
GOLGA2A0A0C4DGS54EBI-1567797,EBI-11522202
HNRNPKP61978-24EBI-1567797,EBI-7060731
MKRN3Q130644EBI-1567797,EBI-2340269
PNMA1Q8ND904EBI-1567797,EBI-302345
PRPF6O949062EBI-1567797,EBI-536755
TFIP11Q9UBB94EBI-1567797,EBI-1105213

Protein-protein interaction databases

BioGridi117563. 137 interactors.
IntActiQ8WWY3. 108 interactors.
MINTiMINT-3047742.
STRINGi9606.ENSP00000324122.

Structurei

Secondary structure

1499
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi89 – 118Combined sources30
Turni119 – 121Combined sources3
Helixi125 – 128Combined sources4
Helixi132 – 142Combined sources11
Helixi146 – 148Combined sources3
Helixi149 – 151Combined sources3
Helixi155 – 157Combined sources3
Helixi161 – 172Combined sources12
Helixi181 – 215Combined sources35
Helixi217 – 235Combined sources19
Helixi238 – 242Combined sources5
Helixi246 – 249Combined sources4
Turni250 – 253Combined sources4
Turni273 – 276Combined sources4
Helixi278 – 281Combined sources4
Helixi285 – 287Combined sources3
Helixi288 – 307Combined sources20
Helixi315 – 331Combined sources17

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OZBX-ray2.60B/E78-333[»]
3JCRelectron microscopy7.00J1-499[»]
3SIUX-ray2.63B/E85-333[»]
3SIVX-ray3.30B/E/H/K85-333[»]
ProteinModelPortaliQ8WWY3.
SMRiQ8WWY3.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WWY3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini215 – 333NopPROSITE-ProRule annotationAdd BLAST119

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili85 – 1201 PublicationAdd BLAST36
Coiled coili181 – 2151 PublicationAdd BLAST35

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi351 – 364Nuclear localization signal (NLS)Add BLAST14

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi16 – 19Poly-Glu4
Compositional biasi25 – 29Poly-Glu5

Domaini

Interacts with the snRNP via the Nop domain.
The coiled coil domain is formed by two non-contiguous helices.

Sequence similaritiesi

Belongs to the PRP31 family.Curated
Contains 1 Nop domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2574. Eukaryota.
COG1498. LUCA.
GeneTreeiENSGT00550000075069.
HOGENOMiHOG000207983.
HOVERGENiHBG082193.
InParanoidiQ8WWY3.
KOiK12844.
OMAiCDMAVEL.
OrthoDBiEOG091G09U7.
PhylomeDBiQ8WWY3.
TreeFamiTF300677.

Family and domain databases

InterProiIPR002687. Nop_dom.
IPR012976. NOSIC.
IPR027105. Prp31.
IPR019175. Prp31_C.
[Graphical view]
PANTHERiPTHR13904. PTHR13904. 1 hit.
PfamiPF01798. Nop. 1 hit.
PF09785. Prp31_C. 1 hit.
[Graphical view]
SMARTiSM00931. NOSIC. 1 hit.
[Graphical view]
SUPFAMiSSF89124. SSF89124. 1 hit.
PROSITEiPS51358. NOP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WWY3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLADELLAD LEEAAEEEEG GSYGEEEEEP AIEDVQEETQ LDLSGDSVKT
60 70 80 90 100
IAKLWDSKMF AEIMMKIEEY ISKQAKASEV MGPVEAAPEY RVIVDANNLT
110 120 130 140 150
VEIENELNII HKFIRDKYSK RFPELESLVP NALDYIRTVK ELGNSLDKCK
160 170 180 190 200
NNENLQQILT NATIMVVSVT ASTTQGQQLS EEELERLEEA CDMALELNAS
210 220 230 240 250
KHRIYEYVES RMSFIAPNLS IIIGASTAAK IMGVAGGLTN LSKMPACNIM
260 270 280 290 300
LLGAQRKTLS GFSSTSVLPH TGYIYHSDIV QSLPPDLRRK AARLVAAKCT
310 320 330 340 350
LAARVDSFHE STEGKVGYEL KDEIERKFDK WQEPPPVKQV KPLPAPLDGQ
360 370 380 390 400
RKKRGGRRYR KMKERLGLTE IRKQANRMSF GEIEEDAYQE DLGFSLGHLG
410 420 430 440 450
KSGSGRVRQT QVNEATKARI SKTLQRTLQK QSVVYGGKST IRDRSSGTAS
460 470 480 490
SVAFTPLQGL EIVNPQAAEK KVAEANQKYF SSMAEFLKVK GEKSGLMST
Length:499
Mass (Da):55,456
Last modified:March 21, 2006 - v2
Checksum:i7B50EC4C3393795C
GO
Isoform 2 (identifier: Q8WWY3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     333-364: EPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKE → RRRWLRPTRSISPAWLSSSRSRARRVALCPPE
     365-499: Missing.

Note: No experimental confirmation available.
Show »
Length:364
Mass (Da):40,779
Checksum:i799839F6D6489EEB
GO
Isoform 3 (identifier: Q8WWY3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.
     359-499: Missing.

Note: No experimental confirmation available.
Show »
Length:278
Mass (Da):30,966
Checksum:i9FCE9E591AF0B586
GO
Isoform 4 (identifier: Q8WWY3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     426-499: RTLQKQSVVY...KGEKSGLMST → VWARPRWGWG...PSPHSRAWRL

Note: No experimental confirmation available.
Show »
Length:491
Mass (Da):54,909
Checksum:i78141E2A6DB6B1FB
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti188E → D in AAK77986 (PubMed:11867543).Curated1
Sequence conflicti235A → G in AAG48270 (PubMed:12747765).Curated1
Sequence conflicti244M → V in CAB43677 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025629111 – 114Missing in RP11; high penetrance. 1 Publication4
Natural variantiVAR_025630194A → E in RP11; mislocation of the protein in the cytoplasm and reduced interaction with PRPF6; the result may be a deficiency in splicing function in the retina. 3 PublicationsCorresponds to variant rs119475043dbSNPEnsembl.1
Natural variantiVAR_025631216A → P in RP11; mislocation of the protein in the cytoplasm, but no effect on interaction with PRPF6; the result may be a deficiency in splicing function in the retina. 4 PublicationsCorresponds to variant rs119475042dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0175811 – 80Missing in isoform 3. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_017582333 – 364EPPPV…RKMKE → RRRWLRPTRSISPAWLSSSR SRARRVALCPPE in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_017583359 – 499Missing in isoform 3. 1 PublicationAdd BLAST141
Alternative sequenceiVSP_017584365 – 499Missing in isoform 2. 1 PublicationAdd BLAST135
Alternative sequenceiVSP_057390426 – 499RTLQK…GLMST → VWARPRWGWGPRDTRWGEPR SQPPCPPHSGPCRSRASYMA GSPPSATAPRARPPAWPSPH SRAWRL in isoform 4. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY040822 mRNA. Translation: AAK77986.1.
AF308303 mRNA. Translation: AAG48270.1.
AL050369 mRNA. Translation: CAB43677.1.
AK098547 mRNA. Translation: BAC05329.1.
AB593024 mRNA. Translation: BAJ83978.1.
AC012314 Genomic DNA. No translation available.
AC245052 Genomic DNA. No translation available.
BC117389 mRNA. Translation: AAI17390.1.
CCDSiCCDS12879.1. [Q8WWY3-1]
RefSeqiNP_056444.3. NM_015629.3. [Q8WWY3-1]
XP_006723200.1. XM_006723137.3. [Q8WWY3-1]
UniGeneiHs.515598.

Genome annotation databases

EnsembliENST00000321030; ENSP00000324122; ENSG00000105618. [Q8WWY3-1]
ENST00000419967; ENSP00000405166; ENSG00000105618. [Q8WWY3-4]
ENST00000610903; ENSP00000484896; ENSG00000277154. [Q8WWY3-1]
ENST00000612749; ENSP00000478804; ENSG00000276421. [Q8WWY3-4]
ENST00000613693; ENSP00000483929; ENSG00000275885. [Q8WWY3-1]
ENST00000614518; ENSP00000484151; ENSG00000274651. [Q8WWY3-4]
ENST00000615175; ENSP00000479700; ENSG00000274144. [Q8WWY3-4]
ENST00000616732; ENSP00000485017; ENSG00000276421. [Q8WWY3-1]
ENST00000618595; ENSP00000483382; ENSG00000274894. [Q8WWY3-4]
ENST00000618937; ENSP00000480434; ENSG00000274651. [Q8WWY3-1]
ENST00000619220; ENSP00000484834; ENSG00000277953. [Q8WWY3-4]
ENST00000619391; ENSP00000480636; ENSG00000275885. [Q8WWY3-4]
ENST00000619439; ENSP00000480725; ENSG00000274894. [Q8WWY3-1]
ENST00000619956; ENSP00000481201; ENSG00000275117. [Q8WWY3-1]
ENST00000620142; ENSP00000482626; ENSG00000274144. [Q8WWY3-1]
ENST00000620861; ENSP00000480726; ENSG00000277707. [Q8WWY3-1]
ENST00000621588; ENSP00000481708; ENSG00000277154. [Q8WWY3-4]
ENST00000622300; ENSP00000481654; ENSG00000277953. [Q8WWY3-1]
ENST00000622387; ENSP00000483982; ENSG00000275117. [Q8WWY3-4]
ENST00000622636; ENSP00000477787; ENSG00000277707. [Q8WWY3-4]
GeneIDi26121.
KEGGihsa:26121.
UCSCiuc002qdh.3. human. [Q8WWY3-1]
uc061cmv.1. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY040822 mRNA. Translation: AAK77986.1.
AF308303 mRNA. Translation: AAG48270.1.
AL050369 mRNA. Translation: CAB43677.1.
AK098547 mRNA. Translation: BAC05329.1.
AB593024 mRNA. Translation: BAJ83978.1.
AC012314 Genomic DNA. No translation available.
AC245052 Genomic DNA. No translation available.
BC117389 mRNA. Translation: AAI17390.1.
CCDSiCCDS12879.1. [Q8WWY3-1]
RefSeqiNP_056444.3. NM_015629.3. [Q8WWY3-1]
XP_006723200.1. XM_006723137.3. [Q8WWY3-1]
UniGeneiHs.515598.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OZBX-ray2.60B/E78-333[»]
3JCRelectron microscopy7.00J1-499[»]
3SIUX-ray2.63B/E85-333[»]
3SIVX-ray3.30B/E/H/K85-333[»]
ProteinModelPortaliQ8WWY3.
SMRiQ8WWY3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117563. 137 interactors.
IntActiQ8WWY3. 108 interactors.
MINTiMINT-3047742.
STRINGi9606.ENSP00000324122.

PTM databases

iPTMnetiQ8WWY3.
PhosphoSitePlusiQ8WWY3.

Polymorphism and mutation databases

BioMutaiPRPF31.
DMDMi90101442.

Proteomic databases

EPDiQ8WWY3.
MaxQBiQ8WWY3.
PaxDbiQ8WWY3.
PeptideAtlasiQ8WWY3.
PRIDEiQ8WWY3.

Protocols and materials databases

DNASUi26121.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321030; ENSP00000324122; ENSG00000105618. [Q8WWY3-1]
ENST00000419967; ENSP00000405166; ENSG00000105618. [Q8WWY3-4]
ENST00000610903; ENSP00000484896; ENSG00000277154. [Q8WWY3-1]
ENST00000612749; ENSP00000478804; ENSG00000276421. [Q8WWY3-4]
ENST00000613693; ENSP00000483929; ENSG00000275885. [Q8WWY3-1]
ENST00000614518; ENSP00000484151; ENSG00000274651. [Q8WWY3-4]
ENST00000615175; ENSP00000479700; ENSG00000274144. [Q8WWY3-4]
ENST00000616732; ENSP00000485017; ENSG00000276421. [Q8WWY3-1]
ENST00000618595; ENSP00000483382; ENSG00000274894. [Q8WWY3-4]
ENST00000618937; ENSP00000480434; ENSG00000274651. [Q8WWY3-1]
ENST00000619220; ENSP00000484834; ENSG00000277953. [Q8WWY3-4]
ENST00000619391; ENSP00000480636; ENSG00000275885. [Q8WWY3-4]
ENST00000619439; ENSP00000480725; ENSG00000274894. [Q8WWY3-1]
ENST00000619956; ENSP00000481201; ENSG00000275117. [Q8WWY3-1]
ENST00000620142; ENSP00000482626; ENSG00000274144. [Q8WWY3-1]
ENST00000620861; ENSP00000480726; ENSG00000277707. [Q8WWY3-1]
ENST00000621588; ENSP00000481708; ENSG00000277154. [Q8WWY3-4]
ENST00000622300; ENSP00000481654; ENSG00000277953. [Q8WWY3-1]
ENST00000622387; ENSP00000483982; ENSG00000275117. [Q8WWY3-4]
ENST00000622636; ENSP00000477787; ENSG00000277707. [Q8WWY3-4]
GeneIDi26121.
KEGGihsa:26121.
UCSCiuc002qdh.3. human. [Q8WWY3-1]
uc061cmv.1. human.

Organism-specific databases

CTDi26121.
DisGeNETi26121.
GeneCardsiPRPF31.
GeneReviewsiPRPF31.
H-InvDBHIX0027609.
HIX0137464.
HGNCiHGNC:15446. PRPF31.
HPAiHPA041939.
HPA061873.
MalaCardsiPRPF31.
MIMi600138. phenotype.
606419. gene.
neXtProtiNX_Q8WWY3.
OpenTargetsiENSG00000105618.
ENSG00000274144.
ENSG00000274651.
ENSG00000274894.
ENSG00000275117.
ENSG00000275885.
ENSG00000276421.
ENSG00000277154.
ENSG00000277707.
ENSG00000277953.
Orphaneti791. Retinitis pigmentosa.
PharmGKBiPA33814.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2574. Eukaryota.
COG1498. LUCA.
GeneTreeiENSGT00550000075069.
HOGENOMiHOG000207983.
HOVERGENiHBG082193.
InParanoidiQ8WWY3.
KOiK12844.
OMAiCDMAVEL.
OrthoDBiEOG091G09U7.
PhylomeDBiQ8WWY3.
TreeFamiTF300677.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000105618-MONOMER.
ReactomeiR-HSA-72163. mRNA Splicing - Major Pathway.

Miscellaneous databases

EvolutionaryTraceiQ8WWY3.
GeneWikiiPRPF31.
GenomeRNAii26121.
PROiQ8WWY3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105618.
CleanExiHS_PRPF31.
ExpressionAtlasiQ8WWY3. baseline and differential.
GenevisibleiQ8WWY3. HS.

Family and domain databases

InterProiIPR002687. Nop_dom.
IPR012976. NOSIC.
IPR027105. Prp31.
IPR019175. Prp31_C.
[Graphical view]
PANTHERiPTHR13904. PTHR13904. 1 hit.
PfamiPF01798. Nop. 1 hit.
PF09785. Prp31_C. 1 hit.
[Graphical view]
SMARTiSM00931. NOSIC. 1 hit.
[Graphical view]
SUPFAMiSSF89124. SSF89124. 1 hit.
PROSITEiPS51358. NOP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPRP31_HUMAN
AccessioniPrimary (citable) accession number: Q8WWY3
Secondary accession number(s): E7ESA8
, F1T0A4, Q17RB4, Q8N7F9, Q9H271, Q9Y439
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: March 21, 2006
Last modified: November 30, 2016
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.