Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/myo-inositol cotransporter 2

Gene

SLC5A11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the sodium-dependent cotransport of myo-inositol (MI) with a Na+:MI stoichiometry of 2:1. Exclusively responsible for apical MI transport and absorption in intestine. Also can transport D-chiro-inositol (DCI) but not L-fructose. Exhibits stereospecific cotransport of both D-glucose and D-xylose. May induce apoptosis through the TNF-alpha, PDCD1 pathway. May play a role in the regulation of MI concentration in serum, involving reabsorption in at least the proximal tubule of the kidney.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis, Ion transport, Sodium transport, Sugar transport, Symport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiR-HSA-429593. Inositol transporters.

Protein family/group databases

TCDBi2.A.21.3.6. the solute:sodium symporter (sss) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/myo-inositol cotransporter 2
Short name:
Na(+)/myo-inositol cotransporter 2
Alternative name(s):
Sodium-dependent glucose cotransporter
Sodium/glucose cotransporter KST1
Sodium/myo-inositol transporter 2
Short name:
SMIT2
Solute carrier family 5 member 11
Gene namesi
Name:SLC5A11Imported
Synonyms:KST11 Publication, SLGTXImported, SMIT2By similarity
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:23091. SLC5A11.

Subcellular locationi

  • Membrane By similarity; Multi-pass membrane protein By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2727ExtracellularSequence analysisAdd
BLAST
Transmembranei28 – 4821HelicalSequence analysisAdd
BLAST
Topological domaini49 – 6517CytoplasmicSequence analysisAdd
BLAST
Transmembranei66 – 8823HelicalSequence analysisAdd
BLAST
Topological domaini89 – 10214ExtracellularSequence analysisAdd
BLAST
Transmembranei103 – 12321HelicalSequence analysisAdd
BLAST
Topological domaini124 – 13512CytoplasmicSequence analysisAdd
BLAST
Transmembranei136 – 15621HelicalSequence analysisAdd
BLAST
Topological domaini157 – 18024ExtracellularSequence analysisAdd
BLAST
Transmembranei181 – 20121HelicalSequence analysisAdd
BLAST
Topological domaini202 – 2087CytoplasmicSequence analysis
Transmembranei209 – 22921HelicalSequence analysisAdd
BLAST
Topological domaini230 – 27243ExtracellularSequence analysisAdd
BLAST
Transmembranei273 – 29321HelicalSequence analysisAdd
BLAST
Topological domaini294 – 30815CytoplasmicSequence analysisAdd
BLAST
Transmembranei309 – 32921HelicalSequence analysisAdd
BLAST
Topological domaini330 – 37546ExtracellularSequence analysisAdd
BLAST
Transmembranei376 – 39621HelicalSequence analysisAdd
BLAST
Topological domaini397 – 41822CytoplasmicSequence analysisAdd
BLAST
Transmembranei419 – 43921HelicalSequence analysisAdd
BLAST
Topological domaini440 – 4467ExtracellularSequence analysis
Transmembranei447 – 46721HelicalSequence analysisAdd
BLAST
Topological domaini468 – 47912CytoplasmicSequence analysisAdd
BLAST
Transmembranei480 – 50021HelicalSequence analysisAdd
BLAST
Topological domaini501 – 52121ExtracellularSequence analysisAdd
BLAST
Transmembranei522 – 54221HelicalSequence analysisAdd
BLAST
Topological domaini543 – 654112CytoplasmicSequence analysisAdd
BLAST
Transmembranei655 – 67521HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134923660.

Chemistry

ChEMBLiCHEMBL1744524.
GuidetoPHARMACOLOGYi925.

Polymorphism and mutation databases

BioMutaiSLC5A11.
DMDMi74751588.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 675675Sodium/myo-inositol cotransporter 2PRO_0000331568Add
BLAST

Proteomic databases

PaxDbiQ8WWX8.
PeptideAtlasiQ8WWX8.
PRIDEiQ8WWX8.

PTM databases

iPTMnetiQ8WWX8.
PhosphoSiteiQ8WWX8.

Expressioni

Tissue specificityi

Highest expression in heart, skeletal muscle, kidney, liver and placenta. Weaker expression in brain, colon, spleen, lung and peripheral blood leukocytes.1 Publication

Gene expression databases

BgeeiQ8WWX8.
CleanExiHS_SLC5A11.
ExpressionAtlasiQ8WWX8. baseline and differential.
GenevisibleiQ8WWX8. HS.

Organism-specific databases

HPAiHPA035331.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KPNA3Q8IYQ93EBI-10277669,EBI-742146

Protein-protein interaction databases

BioGridi125441. 2 interactions.
IntActiQ8WWX8. 1 interaction.
STRINGi9606.ENSP00000289932.

Chemistry

BindingDBiQ8WWX8.

Structurei

3D structure databases

ProteinModelPortaliQ8WWX8.
SMRiQ8WWX8. Positions 67-537.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IP49. Eukaryota.
COG4146. LUCA.
GeneTreeiENSGT00760000118955.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
InParanoidiQ8WWX8.
KOiK14391.
OMAiWSMWRTK.
OrthoDBiEOG77126J.
PhylomeDBiQ8WWX8.
TreeFamiTF352855.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 2 hits.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q8WWX8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESGTSSPQP PQLDPLDAFP QKGLEPGDIA VLVLYFLFVL AVGLWSTVKT
60 70 80 90 100
KRDTVKGYFL AGGDMVWWPV GASLFASNVG SGHFIGLAGS GAATGISVSA
110 120 130 140 150
YELNGLFSVL MLAWIFLPIY IAGQVTTMPE YLRKRFGGIR IPIILAVLYL
160 170 180 190 200
FIYIFTKISV DMYAGAIFIQ QSLHLDLYLA IVGLLAITAV YTVAGGLAAV
210 220 230 240 250
IYTDALQTLI MLIGALTLMG YSFAAVGGME GLKEKYFLAL ASNRSENSSC
260 270 280 290 300
GLPREDAFHI FRDPLTSDLP WPGVLFGMSI PSLWYWCTDQ VIVQRTLAAK
310 320 330 340 350
NLSHAKGGAL MAAYLKVLPL FIMVFPGMVS RILFPDQVAC ADPEICQKIC
360 370 380 390 400
SNPSGCSDIA YPKLVLELLP TGLRGLMMAV MVAALMSSLT SIFNSASTIF
410 420 430 440 450
TMDLWNHLRP RASEKELMIV GRVFVLLLVL VSILWIPVVQ ASQGGQLFIY
460 470 480 490 500
IQSISSYLQP PVAVVFIMGC FWKRTNEKGA FWGLISGLLL GLVRLVLDFI
510 520 530 540 550
YVQPRCDQPD ERPVLVKSIH YLYFSMILST VTLITVSTVS WFTEPPSKEM
560 570 580 590 600
VSHLTWFTRH DPVVQKEQAP PAAPLSLTLS QNGMPEASSS SSVQFEMVQE
610 620 630 640 650
NTSKTHSCDM TPKQSKVVKA ILWLCGIQEK GKEELPARAE AIIVSLEENP
660 670
LVKTLLDVNL IFCVSCAIFI WGYFA
Length:675
Mass (Da):74,036
Last modified:March 1, 2002 - v1
Checksum:i44F7BA6D2FE92335
GO
Isoform 21 Publication (identifier: Q8WWX8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-159: Missing.

Show »
Length:640
Mass (Da):69,907
Checksum:i022BC26A2571B897
GO
Isoform 31 Publication (identifier: Q8WWX8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:611
Mass (Da):67,171
Checksum:iA5B41D063A056229
GO
Isoform 4 (identifier: Q8WWX8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: W → WVGSPSVAQGTRTQWWQSWLTPASTSWAQVILSPRLPDTEEVLSTRNRLSPDTKPLGALILNFQVSRI

Note: No experimental confirmation available.
Show »
Length:742
Mass (Da):81,465
Checksum:iF1704416D5A1E875
GO
Isoform 5 (identifier: Q8WWX8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-104: Missing.
     125-159: Missing.

Note: No experimental confirmation available.
Show »
Length:605
Mass (Da):66,643
Checksum:iC6B958E973E76E6E
GO
Isoform 6 (identifier: Q8WWX8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: Missing.
     223-302: FAAVGGMEGL...VQRTLAAKNL → DCPADSGCQE...SQTRAGTPAH
     303-394: Missing.

Note: No experimental confirmation available.
Show »
Length:519
Mass (Da):57,098
Checksum:i8C0B47EEA9EEDE14
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti41 – 411A → T in AAK97053 (Ref. 2) Curated
Sequence conflicti371 – 3711T → P in CAC83728 (Ref. 3) Curated
Sequence conflicti547 – 5471S → P in BAC86105 (Ref. 6) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti47 – 471T → P.
Corresponds to variant rs36048966 [ dbSNP | Ensembl ].
VAR_052494
Natural varianti182 – 1821V → A Reduces serum myo-inositol concentration. 4 Publications
Corresponds to variant rs11074656 [ dbSNP | Ensembl ].
VAR_042896
Natural varianti258 – 2581F → L.1 Publication
Corresponds to variant rs35993597 [ dbSNP | Ensembl ].
VAR_042897
Natural varianti452 – 4521Q → R.1 Publication
Corresponds to variant rs17854935 [ dbSNP | Ensembl ].
VAR_042898
Natural varianti526 – 5261M → I.1 Publication
VAR_042899
Natural varianti539 – 5391V → M.
Corresponds to variant rs35038575 [ dbSNP | Ensembl ].
VAR_061877

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6464Missing in isoform 3 and isoform 6. 1 PublicationVSP_052789Add
BLAST
Alternative sequencei45 – 451W → WVGSPSVAQGTRTQWWQSWL TPASTSWAQVILSPRLPDTE EVLSTRNRLSPDTKPLGALI LNFQVSRI in isoform 4. 1 PublicationVSP_033259
Alternative sequencei70 – 10435Missing in isoform 5. 1 PublicationVSP_045034Add
BLAST
Alternative sequencei125 – 15935Missing in isoform 2 and isoform 5. 2 PublicationsVSP_052790Add
BLAST
Alternative sequencei223 – 30280FAAVG…AAKNL → DCPADSGCQEPVPCQRRCSD GCIPEGAAPLHNGVPWDGQP HPLPRSSGLCRSRDLPEDLQ QPLRLFGHRVSQTRAGTPAH in isoform 6. 1 PublicationVSP_045035Add
BLAST
Alternative sequencei303 – 39492Missing in isoform 6. 1 PublicationVSP_045036Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY044906 mRNA. Translation: AAK97784.1.
AF292385 mRNA. Translation: AAK97053.1.
AJ305237 mRNA. Translation: CAC83728.1.
AK125267 mRNA. Translation: BAC86105.1.
AK295427 mRNA. Translation: BAH12065.1.
AC008731 Genomic DNA. No translation available.
CH471145 Genomic DNA. Translation: EAW55781.1.
BC049385 mRNA. Translation: AAH49385.1.
BC057780 mRNA. Translation: AAH57780.1.
CCDSiCCDS10625.1. [Q8WWX8-1]
CCDS58437.1. [Q8WWX8-2]
CCDS58438.1. [Q8WWX8-5]
CCDS58439.1. [Q8WWX8-3]
CCDS58440.1. [Q8WWX8-6]
RefSeqiNP_001245340.1. NM_001258411.2. [Q8WWX8-2]
NP_001245341.1. NM_001258412.2. [Q8WWX8-5]
NP_001245342.1. NM_001258413.2. [Q8WWX8-3]
NP_001245343.1. NM_001258414.1. [Q8WWX8-6]
NP_443176.2. NM_052944.4. [Q8WWX8-1]
XP_005255137.1. XM_005255080.2. [Q8WWX8-1]
UniGeneiHs.164118.

Genome annotation databases

EnsembliENST00000347898; ENSP00000289932; ENSG00000158865. [Q8WWX8-1]
ENST00000424767; ENSP00000416782; ENSG00000158865. [Q8WWX8-2]
ENST00000449109; ENSP00000389606; ENSG00000158865. [Q8WWX8-6]
ENST00000545376; ENSP00000441384; ENSG00000158865. [Q8WWX8-5]
ENST00000565769; ENSP00000457179; ENSG00000158865. [Q8WWX8-3]
ENST00000567758; ENSP00000454401; ENSG00000158865. [Q8WWX8-2]
ENST00000568579; ENSP00000456234; ENSG00000158865. [Q8WWX8-5]
ENST00000569071; ENSP00000456376; ENSG00000158865. [Q8WWX8-6]
GeneIDi115584.
KEGGihsa:115584.
UCSCiuc002dms.5. human. [Q8WWX8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY044906 mRNA. Translation: AAK97784.1.
AF292385 mRNA. Translation: AAK97053.1.
AJ305237 mRNA. Translation: CAC83728.1.
AK125267 mRNA. Translation: BAC86105.1.
AK295427 mRNA. Translation: BAH12065.1.
AC008731 Genomic DNA. No translation available.
CH471145 Genomic DNA. Translation: EAW55781.1.
BC049385 mRNA. Translation: AAH49385.1.
BC057780 mRNA. Translation: AAH57780.1.
CCDSiCCDS10625.1. [Q8WWX8-1]
CCDS58437.1. [Q8WWX8-2]
CCDS58438.1. [Q8WWX8-5]
CCDS58439.1. [Q8WWX8-3]
CCDS58440.1. [Q8WWX8-6]
RefSeqiNP_001245340.1. NM_001258411.2. [Q8WWX8-2]
NP_001245341.1. NM_001258412.2. [Q8WWX8-5]
NP_001245342.1. NM_001258413.2. [Q8WWX8-3]
NP_001245343.1. NM_001258414.1. [Q8WWX8-6]
NP_443176.2. NM_052944.4. [Q8WWX8-1]
XP_005255137.1. XM_005255080.2. [Q8WWX8-1]
UniGeneiHs.164118.

3D structure databases

ProteinModelPortaliQ8WWX8.
SMRiQ8WWX8. Positions 67-537.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125441. 2 interactions.
IntActiQ8WWX8. 1 interaction.
STRINGi9606.ENSP00000289932.

Chemistry

BindingDBiQ8WWX8.
ChEMBLiCHEMBL1744524.
GuidetoPHARMACOLOGYi925.

Protein family/group databases

TCDBi2.A.21.3.6. the solute:sodium symporter (sss) family.

PTM databases

iPTMnetiQ8WWX8.
PhosphoSiteiQ8WWX8.

Polymorphism and mutation databases

BioMutaiSLC5A11.
DMDMi74751588.

Proteomic databases

PaxDbiQ8WWX8.
PeptideAtlasiQ8WWX8.
PRIDEiQ8WWX8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000347898; ENSP00000289932; ENSG00000158865. [Q8WWX8-1]
ENST00000424767; ENSP00000416782; ENSG00000158865. [Q8WWX8-2]
ENST00000449109; ENSP00000389606; ENSG00000158865. [Q8WWX8-6]
ENST00000545376; ENSP00000441384; ENSG00000158865. [Q8WWX8-5]
ENST00000565769; ENSP00000457179; ENSG00000158865. [Q8WWX8-3]
ENST00000567758; ENSP00000454401; ENSG00000158865. [Q8WWX8-2]
ENST00000568579; ENSP00000456234; ENSG00000158865. [Q8WWX8-5]
ENST00000569071; ENSP00000456376; ENSG00000158865. [Q8WWX8-6]
GeneIDi115584.
KEGGihsa:115584.
UCSCiuc002dms.5. human. [Q8WWX8-1]

Organism-specific databases

CTDi115584.
GeneCardsiSLC5A11.
H-InvDBHIX0026944.
HGNCiHGNC:23091. SLC5A11.
HPAiHPA035331.
MIMi610238. gene.
neXtProtiNX_Q8WWX8.
PharmGKBiPA134923660.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IP49. Eukaryota.
COG4146. LUCA.
GeneTreeiENSGT00760000118955.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
InParanoidiQ8WWX8.
KOiK14391.
OMAiWSMWRTK.
OrthoDBiEOG77126J.
PhylomeDBiQ8WWX8.
TreeFamiTF352855.

Enzyme and pathway databases

ReactomeiR-HSA-429593. Inositol transporters.

Miscellaneous databases

GenomeRNAii115584.
PROiQ8WWX8.
SOURCEiSearch...

Gene expression databases

BgeeiQ8WWX8.
CleanExiHS_SLC5A11.
ExpressionAtlasiQ8WWX8. baseline and differential.
GenevisibleiQ8WWX8. HS.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 2 hits.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "New human sodium/glucose cotransporter gene (KST1): identification, characterization, and mutation analysis in ICCA (infantile convulsions and choreoathetosis) and BFIC (benign familial infantile convulsions) families."
    Roll P., Massacrier A., Pereira S., Robaglia-Schlupp A., Cau P., Szepetowski P.
    Gene 285:141-148(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, VARIANTS ALA-182; LEU-258 AND ILE-526.
    Tissue: Brain1 Publication.
  2. "Cloning of the human ortholog of RKST1, a member of the SGLT gene family of sodium-coupled cotransporters."
    Mount D.B.
    Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-182.
  3. "Cloning and functional characterization of a new human sugar transporter in kidney."
    Bruss M., Bonisch H.
    Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: KidneyImported.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), VARIANT ALA-182.
    Tissue: Corpus callosum and KidneyImported.
  5. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 6), VARIANT ARG-452.
    Tissue: Brain and HypothalamusImported.
  8. Cited for: FUNCTION, VARIANT ALA-182.
  9. "The sodium-dependent glucose cotransporter SLC5A11 as an autoimmune modifier gene in SLE."
    Tsai L.-J., Hsiao S.-H., Tsai L.-M., Lin C.-Y., Tsai J.-J., Liou D.-M., Lan J.-L.
    Tissue Antigens 71:114-126(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: POSSIBLE ROLE IN SLE.

Entry informationi

Entry nameiSC5AB_HUMAN
AccessioniPrimary (citable) accession number: Q8WWX8
Secondary accession number(s): B7Z329
, Q05BF1, Q6PF02, Q6ZUW3, Q86Y55, Q96PP5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: July 6, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Acts as an autoimmune modifier in systemic lupus erythematosus (SLE) as it is significantly associated with low complement component 4 (C4), anti-Smith antibody, serositis, and alopecia.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.