Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/myo-inositol cotransporter 2

Gene

SLC5A11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the sodium-dependent cotransport of myo-inositol (MI) with a Na+:MI stoichiometry of 2:1. Exclusively responsible for apical MI transport and absorption in intestine. Also can transport D-chiro-inositol (DCI) but not L-fructose. Exhibits stereospecific cotransport of both D-glucose and D-xylose. May induce apoptosis through the TNF-alpha, PDCD1 pathway. May play a role in the regulation of MI concentration in serum, involving reabsorption in at least the proximal tubule of the kidney.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis, Ion transport, Sodium transport, Sugar transport, Symport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

BioCyciZFISH:ENSG00000158865-MONOMER.
ReactomeiR-HSA-429593. Inositol transporters.

Protein family/group databases

TCDBi2.A.21.3.6. the solute:sodium symporter (sss) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/myo-inositol cotransporter 2
Short name:
Na(+)/myo-inositol cotransporter 2
Alternative name(s):
Sodium-dependent glucose cotransporter
Sodium/glucose cotransporter KST1
Sodium/myo-inositol transporter 2
Short name:
SMIT2
Solute carrier family 5 member 11
Gene namesi
Name:SLC5A11Imported
Synonyms:KST11 Publication, SLGTXImported, SMIT2By similarity
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:23091. SLC5A11.

Subcellular locationi

  • Membrane By similarity; Multi-pass membrane protein By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 27ExtracellularSequence analysisAdd BLAST27
Transmembranei28 – 48HelicalSequence analysisAdd BLAST21
Topological domaini49 – 65CytoplasmicSequence analysisAdd BLAST17
Transmembranei66 – 88HelicalSequence analysisAdd BLAST23
Topological domaini89 – 102ExtracellularSequence analysisAdd BLAST14
Transmembranei103 – 123HelicalSequence analysisAdd BLAST21
Topological domaini124 – 135CytoplasmicSequence analysisAdd BLAST12
Transmembranei136 – 156HelicalSequence analysisAdd BLAST21
Topological domaini157 – 180ExtracellularSequence analysisAdd BLAST24
Transmembranei181 – 201HelicalSequence analysisAdd BLAST21
Topological domaini202 – 208CytoplasmicSequence analysis7
Transmembranei209 – 229HelicalSequence analysisAdd BLAST21
Topological domaini230 – 272ExtracellularSequence analysisAdd BLAST43
Transmembranei273 – 293HelicalSequence analysisAdd BLAST21
Topological domaini294 – 308CytoplasmicSequence analysisAdd BLAST15
Transmembranei309 – 329HelicalSequence analysisAdd BLAST21
Topological domaini330 – 375ExtracellularSequence analysisAdd BLAST46
Transmembranei376 – 396HelicalSequence analysisAdd BLAST21
Topological domaini397 – 418CytoplasmicSequence analysisAdd BLAST22
Transmembranei419 – 439HelicalSequence analysisAdd BLAST21
Topological domaini440 – 446ExtracellularSequence analysis7
Transmembranei447 – 467HelicalSequence analysisAdd BLAST21
Topological domaini468 – 479CytoplasmicSequence analysisAdd BLAST12
Transmembranei480 – 500HelicalSequence analysisAdd BLAST21
Topological domaini501 – 521ExtracellularSequence analysisAdd BLAST21
Transmembranei522 – 542HelicalSequence analysisAdd BLAST21
Topological domaini543 – 654CytoplasmicSequence analysisAdd BLAST112
Transmembranei655 – 675HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi115584.
OpenTargetsiENSG00000158865.
PharmGKBiPA134923660.

Chemistry databases

ChEMBLiCHEMBL1744524.
GuidetoPHARMACOLOGYi925.

Polymorphism and mutation databases

BioMutaiSLC5A11.
DMDMi74751588.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003315681 – 675Sodium/myo-inositol cotransporter 2Add BLAST675

Proteomic databases

PaxDbiQ8WWX8.
PeptideAtlasiQ8WWX8.
PRIDEiQ8WWX8.

PTM databases

iPTMnetiQ8WWX8.
PhosphoSitePlusiQ8WWX8.

Expressioni

Tissue specificityi

Highest expression in heart, skeletal muscle, kidney, liver and placenta. Weaker expression in brain, colon, spleen, lung and peripheral blood leukocytes.1 Publication

Gene expression databases

BgeeiENSG00000158865.
CleanExiHS_SLC5A11.
ExpressionAtlasiQ8WWX8. baseline and differential.
GenevisibleiQ8WWX8. HS.

Organism-specific databases

HPAiHPA035331.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KPNA3Q8IYQ93EBI-10277669,EBI-742146

Protein-protein interaction databases

BioGridi125441. 2 interactors.
IntActiQ8WWX8. 1 interactor.
STRINGi9606.ENSP00000289932.

Chemistry databases

BindingDBiQ8WWX8.

Structurei

3D structure databases

ProteinModelPortaliQ8WWX8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IP49. Eukaryota.
COG4146. LUCA.
GeneTreeiENSGT00760000118955.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
InParanoidiQ8WWX8.
KOiK14391.
OMAiKTHSCDM.
OrthoDBiEOG091G077U.
PhylomeDBiQ8WWX8.
TreeFamiTF352855.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 2 hits.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q8WWX8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESGTSSPQP PQLDPLDAFP QKGLEPGDIA VLVLYFLFVL AVGLWSTVKT
60 70 80 90 100
KRDTVKGYFL AGGDMVWWPV GASLFASNVG SGHFIGLAGS GAATGISVSA
110 120 130 140 150
YELNGLFSVL MLAWIFLPIY IAGQVTTMPE YLRKRFGGIR IPIILAVLYL
160 170 180 190 200
FIYIFTKISV DMYAGAIFIQ QSLHLDLYLA IVGLLAITAV YTVAGGLAAV
210 220 230 240 250
IYTDALQTLI MLIGALTLMG YSFAAVGGME GLKEKYFLAL ASNRSENSSC
260 270 280 290 300
GLPREDAFHI FRDPLTSDLP WPGVLFGMSI PSLWYWCTDQ VIVQRTLAAK
310 320 330 340 350
NLSHAKGGAL MAAYLKVLPL FIMVFPGMVS RILFPDQVAC ADPEICQKIC
360 370 380 390 400
SNPSGCSDIA YPKLVLELLP TGLRGLMMAV MVAALMSSLT SIFNSASTIF
410 420 430 440 450
TMDLWNHLRP RASEKELMIV GRVFVLLLVL VSILWIPVVQ ASQGGQLFIY
460 470 480 490 500
IQSISSYLQP PVAVVFIMGC FWKRTNEKGA FWGLISGLLL GLVRLVLDFI
510 520 530 540 550
YVQPRCDQPD ERPVLVKSIH YLYFSMILST VTLITVSTVS WFTEPPSKEM
560 570 580 590 600
VSHLTWFTRH DPVVQKEQAP PAAPLSLTLS QNGMPEASSS SSVQFEMVQE
610 620 630 640 650
NTSKTHSCDM TPKQSKVVKA ILWLCGIQEK GKEELPARAE AIIVSLEENP
660 670
LVKTLLDVNL IFCVSCAIFI WGYFA
Length:675
Mass (Da):74,036
Last modified:March 1, 2002 - v1
Checksum:i44F7BA6D2FE92335
GO
Isoform 21 Publication (identifier: Q8WWX8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-159: Missing.

Show »
Length:640
Mass (Da):69,907
Checksum:i022BC26A2571B897
GO
Isoform 31 Publication (identifier: Q8WWX8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:611
Mass (Da):67,171
Checksum:iA5B41D063A056229
GO
Isoform 4 (identifier: Q8WWX8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: W → WVGSPSVAQGTRTQWWQSWLTPASTSWAQVILSPRLPDTEEVLSTRNRLSPDTKPLGALILNFQVSRI

Note: No experimental confirmation available.
Show »
Length:742
Mass (Da):81,465
Checksum:iF1704416D5A1E875
GO
Isoform 5 (identifier: Q8WWX8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-104: Missing.
     125-159: Missing.

Note: No experimental confirmation available.
Show »
Length:605
Mass (Da):66,643
Checksum:iC6B958E973E76E6E
GO
Isoform 6 (identifier: Q8WWX8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: Missing.
     223-302: FAAVGGMEGL...VQRTLAAKNL → DCPADSGCQE...SQTRAGTPAH
     303-394: Missing.

Note: No experimental confirmation available.
Show »
Length:519
Mass (Da):57,098
Checksum:i8C0B47EEA9EEDE14
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti41A → T in AAK97053 (Ref. 2) Curated1
Sequence conflicti371T → P in CAC83728 (Ref. 3) Curated1
Sequence conflicti547S → P in BAC86105 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05249447T → P.Corresponds to variant rs36048966dbSNPEnsembl.1
Natural variantiVAR_042896182V → A Reduces serum myo-inositol concentration. 4 PublicationsCorresponds to variant rs11074656dbSNPEnsembl.1
Natural variantiVAR_042897258F → L.1 PublicationCorresponds to variant rs35993597dbSNPEnsembl.1
Natural variantiVAR_042898452Q → R.1 PublicationCorresponds to variant rs17854935dbSNPEnsembl.1
Natural variantiVAR_042899526M → I.1 Publication1
Natural variantiVAR_061877539V → M.Corresponds to variant rs35038575dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0527891 – 64Missing in isoform 3 and isoform 6. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_03325945W → WVGSPSVAQGTRTQWWQSWL TPASTSWAQVILSPRLPDTE EVLSTRNRLSPDTKPLGALI LNFQVSRI in isoform 4. 1 Publication1
Alternative sequenceiVSP_04503470 – 104Missing in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_052790125 – 159Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_045035223 – 302FAAVG…AAKNL → DCPADSGCQEPVPCQRRCSD GCIPEGAAPLHNGVPWDGQP HPLPRSSGLCRSRDLPEDLQ QPLRLFGHRVSQTRAGTPAH in isoform 6. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_045036303 – 394Missing in isoform 6. 1 PublicationAdd BLAST92

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY044906 mRNA. Translation: AAK97784.1.
AF292385 mRNA. Translation: AAK97053.1.
AJ305237 mRNA. Translation: CAC83728.1.
AK125267 mRNA. Translation: BAC86105.1.
AK295427 mRNA. Translation: BAH12065.1.
AC008731 Genomic DNA. No translation available.
CH471145 Genomic DNA. Translation: EAW55781.1.
BC049385 mRNA. Translation: AAH49385.1.
BC057780 mRNA. Translation: AAH57780.1.
CCDSiCCDS10625.1. [Q8WWX8-1]
CCDS58437.1. [Q8WWX8-2]
CCDS58438.1. [Q8WWX8-5]
CCDS58439.1. [Q8WWX8-3]
CCDS58440.1. [Q8WWX8-6]
RefSeqiNP_001245340.1. NM_001258411.2. [Q8WWX8-2]
NP_001245341.1. NM_001258412.2. [Q8WWX8-5]
NP_001245342.1. NM_001258413.2. [Q8WWX8-3]
NP_001245343.1. NM_001258414.1. [Q8WWX8-6]
NP_443176.2. NM_052944.4. [Q8WWX8-1]
XP_005255137.1. XM_005255080.2. [Q8WWX8-1]
XP_016878389.1. XM_017022900.1. [Q8WWX8-1]
XP_016878390.1. XM_017022901.1. [Q8WWX8-1]
XP_016878391.1. XM_017022902.1. [Q8WWX8-1]
XP_016878392.1. XM_017022903.1. [Q8WWX8-1]
XP_016878394.1. XM_017022905.1. [Q8WWX8-2]
XP_016878395.1. XM_017022906.1. [Q8WWX8-3]
UniGeneiHs.164118.

Genome annotation databases

EnsembliENST00000347898; ENSP00000289932; ENSG00000158865. [Q8WWX8-1]
ENST00000424767; ENSP00000416782; ENSG00000158865. [Q8WWX8-2]
ENST00000449109; ENSP00000389606; ENSG00000158865. [Q8WWX8-6]
ENST00000545376; ENSP00000441384; ENSG00000158865. [Q8WWX8-5]
ENST00000565769; ENSP00000457179; ENSG00000158865. [Q8WWX8-3]
ENST00000567758; ENSP00000454401; ENSG00000158865. [Q8WWX8-2]
ENST00000568579; ENSP00000456234; ENSG00000158865. [Q8WWX8-5]
ENST00000569071; ENSP00000456376; ENSG00000158865. [Q8WWX8-6]
GeneIDi115584.
KEGGihsa:115584.
UCSCiuc002dms.5. human. [Q8WWX8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY044906 mRNA. Translation: AAK97784.1.
AF292385 mRNA. Translation: AAK97053.1.
AJ305237 mRNA. Translation: CAC83728.1.
AK125267 mRNA. Translation: BAC86105.1.
AK295427 mRNA. Translation: BAH12065.1.
AC008731 Genomic DNA. No translation available.
CH471145 Genomic DNA. Translation: EAW55781.1.
BC049385 mRNA. Translation: AAH49385.1.
BC057780 mRNA. Translation: AAH57780.1.
CCDSiCCDS10625.1. [Q8WWX8-1]
CCDS58437.1. [Q8WWX8-2]
CCDS58438.1. [Q8WWX8-5]
CCDS58439.1. [Q8WWX8-3]
CCDS58440.1. [Q8WWX8-6]
RefSeqiNP_001245340.1. NM_001258411.2. [Q8WWX8-2]
NP_001245341.1. NM_001258412.2. [Q8WWX8-5]
NP_001245342.1. NM_001258413.2. [Q8WWX8-3]
NP_001245343.1. NM_001258414.1. [Q8WWX8-6]
NP_443176.2. NM_052944.4. [Q8WWX8-1]
XP_005255137.1. XM_005255080.2. [Q8WWX8-1]
XP_016878389.1. XM_017022900.1. [Q8WWX8-1]
XP_016878390.1. XM_017022901.1. [Q8WWX8-1]
XP_016878391.1. XM_017022902.1. [Q8WWX8-1]
XP_016878392.1. XM_017022903.1. [Q8WWX8-1]
XP_016878394.1. XM_017022905.1. [Q8WWX8-2]
XP_016878395.1. XM_017022906.1. [Q8WWX8-3]
UniGeneiHs.164118.

3D structure databases

ProteinModelPortaliQ8WWX8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125441. 2 interactors.
IntActiQ8WWX8. 1 interactor.
STRINGi9606.ENSP00000289932.

Chemistry databases

BindingDBiQ8WWX8.
ChEMBLiCHEMBL1744524.
GuidetoPHARMACOLOGYi925.

Protein family/group databases

TCDBi2.A.21.3.6. the solute:sodium symporter (sss) family.

PTM databases

iPTMnetiQ8WWX8.
PhosphoSitePlusiQ8WWX8.

Polymorphism and mutation databases

BioMutaiSLC5A11.
DMDMi74751588.

Proteomic databases

PaxDbiQ8WWX8.
PeptideAtlasiQ8WWX8.
PRIDEiQ8WWX8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000347898; ENSP00000289932; ENSG00000158865. [Q8WWX8-1]
ENST00000424767; ENSP00000416782; ENSG00000158865. [Q8WWX8-2]
ENST00000449109; ENSP00000389606; ENSG00000158865. [Q8WWX8-6]
ENST00000545376; ENSP00000441384; ENSG00000158865. [Q8WWX8-5]
ENST00000565769; ENSP00000457179; ENSG00000158865. [Q8WWX8-3]
ENST00000567758; ENSP00000454401; ENSG00000158865. [Q8WWX8-2]
ENST00000568579; ENSP00000456234; ENSG00000158865. [Q8WWX8-5]
ENST00000569071; ENSP00000456376; ENSG00000158865. [Q8WWX8-6]
GeneIDi115584.
KEGGihsa:115584.
UCSCiuc002dms.5. human. [Q8WWX8-1]

Organism-specific databases

CTDi115584.
DisGeNETi115584.
GeneCardsiSLC5A11.
H-InvDBHIX0026944.
HGNCiHGNC:23091. SLC5A11.
HPAiHPA035331.
MIMi610238. gene.
neXtProtiNX_Q8WWX8.
OpenTargetsiENSG00000158865.
PharmGKBiPA134923660.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IP49. Eukaryota.
COG4146. LUCA.
GeneTreeiENSGT00760000118955.
HOGENOMiHOG000025422.
HOVERGENiHBG052859.
InParanoidiQ8WWX8.
KOiK14391.
OMAiKTHSCDM.
OrthoDBiEOG091G077U.
PhylomeDBiQ8WWX8.
TreeFamiTF352855.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000158865-MONOMER.
ReactomeiR-HSA-429593. Inositol transporters.

Miscellaneous databases

GenomeRNAii115584.
PROiQ8WWX8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000158865.
CleanExiHS_SLC5A11.
ExpressionAtlasiQ8WWX8. baseline and differential.
GenevisibleiQ8WWX8. HS.

Family and domain databases

InterProiIPR001734. Na/solute_symporter.
[Graphical view]
PANTHERiPTHR11819. PTHR11819. 2 hits.
PfamiPF00474. SSF. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00813. sss. 1 hit.
PROSITEiPS50283. NA_SOLUT_SYMP_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSC5AB_HUMAN
AccessioniPrimary (citable) accession number: Q8WWX8
Secondary accession number(s): B7Z329
, Q05BF1, Q6PF02, Q6ZUW3, Q86Y55, Q96PP5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: November 2, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Acts as an autoimmune modifier in systemic lupus erythematosus (SLE) as it is significantly associated with low complement component 4 (C4), anti-Smith antibody, serositis, and alopecia.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.