Q8WWW0 (RASF5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras association domain-containing protein 5 Alternative name(s): New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues Short name=RAPL | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 418 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Potential tumor suppressor. Seems to be involved in lymphocyte adhesion by linking RAP1A activation upon T-cell receptor or chemokine stimulation to integrin activation. Isoform 2 stimulates lymphocyte polarization and the patch-like distribution of ITGAL/LFA-1, resulting in an enhanced adhesion to ICAM1. Together with RAP1A may participate in regulation of microtubule growth. The association of isoform 2 with activated RAP1A is required for directional movement of endothelial cells during wound healing. May be involved in regulation of Ras apoptotic function. The RASSF5-STK4/MST1 complex may mediate HRAS1 and KRAS induced apoptosis. Ref.2 Ref.9 Ref.11 |
| Subunit structure | Interacts directly with activated HRAS1; a RASSF5-STK4/MST1 complex probably associates with activated HRAS1. Interacts with KRAS. Probably interacts with Ras-like GTPases RRAS, RRAS2, MRAS, RAP1B, RAP2A and RALA. Can self-associate. Interacts with RSSF1 isoform A. The RSSF1 isoform A-RSSF5 heterodimer probably mediates the association of RSSF1 with HRAS1 By similarity. Isoform 2 interacts with activated RAP1A and ITGAL/LFA-1. Binds STK4/MST1, inhibiting STK4/MST1 autoactivation. Ref.2 Ref.10 Ref.11 |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton. Note: Isoform 2 is mainly located in the perinuclear region of unstimulated primary T-cells. Upon stimulation translocates to the leading edge and colocalizes with ITGAL/LFA-1 in the peripheral zone of the immunological synapse. Isoform 2 is localized to growing microtubules in vascular endothelial cells and is dissociated from microtubules by activated RAP1A. Ref.2 Ref.11 |
| Tissue specificity | Widely expressed. Frequently down-regulated in lung tumor cell lines and primary lung tumors. Ref.1 Ref.9 |
| Sequence similarities | Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 Ras-associating domain. Contains 1 SARAH domain. |
| Caution | Was termed (Ref.3) RASSF3. |
| Sequence caution | The sequence AAH04270.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH07203.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cytoplasm Cytoskeleton Microtubule |
| Coding sequence diversity | Alternative splicing |
| Disease | Tumor suppressor |
| Domain | Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Inferred from electronic annotation. Source: UniProtKB-KW intracellular signal transductionInferred from electronic annotation. Source: InterPro |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell microtubuleInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GABARAP | O95166 | 2 | EBI-367390,EBI-712001 | |
| GABARAPL1 | Q9H0R8 | 2 | EBI-367390,EBI-746969 | |
| GABARAPL2 | P60520 | 2 | EBI-367390,EBI-720116 | |
| MAP1LC3B | Q9GZQ8 | 5 | EBI-367390,EBI-373144 | |
| MAP1LC3C | Q9BXW4 | 2 | EBI-367390,EBI-2603996 | |
| RAP1A | P62834 | 3 | EBI-960502,EBI-491414 | |
| STK3 | Q13188 | 3 | EBI-367390,EBI-992580 | |
| STK4 | Q13043 | 4 | EBI-960502,EBI-367376 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WWW0-1) Also known as: A; NORE1A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WWW0-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 1-153: Missing. 154-193: CKFTCHPECR...ESTLTVTFSQ → MTVDSSMSSG...RNAQSKHLSK | ||||||
| Note: Initiator Met-1 is removed. Contains a N-acetylthreonine at position 2. | ||||||
| Isoform 3 (identifier: Q8WWW0-3) Also known as: C; NORE1B; The sequence of this isoform differs from the canonical sequence as follows: 331-336: LFQKLS → GCLLHP 337-418: Missing. | ||||||
| Isoform 4 (identifier: Q8WWW0-4) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 382-418: TILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG → SSWCIQIYLYY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 418 | 418 | Ras association domain-containing protein 5 | PRO_0000240401 | |||||
Regions | |||||||||
| Domain | 274 – 364 | 91 | Ras-associating | ||||||
| Domain | 366 – 413 | 48 | SARAH | ||||||
| Zinc finger | 122 – 170 | 49 | Phorbol-ester/DAG-type | ||||||
Amino acid modifications | |||||||||
| Modified residue | 352 | 1 | Phosphothreonine Ref.12 Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 153 | 153 | Missing in isoform 2. | VSP_019363 | |||||
| Alternative sequence | 154 – 193 | 40 | CKFTC…VTFSQ → MTVDSSMSSGYCSLDEELED CFFTAKTTFFRNAQSKHLSK in isoform 2. | VSP_019364 | |||||
| Alternative sequence | 331 – 336 | 6 | LFQKLS → GCLLHP in isoform 3. | VSP_019365 | |||||
| Alternative sequence | 337 – 418 | 82 | Missing in isoform 3. | VSP_019366 | |||||
| Alternative sequence | 382 – 418 | 37 | TILEK…QGKPG → SSWCIQIYLYY in isoform 4. | VSP_019367 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "RASSF3 and NORE1: identification and cloning of two human homologues of the putative tumor suppressor gene RASSF1." Tommasi S., Dammann R., Jin S.-G., Zhang X.-F., Avruch J., Pfeifer G.P. Oncogene 21:2713-2720(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [2] | "RAPL, a Rap1-binding molecule that mediates Rap1-induced adhesion through spatial regulation of LFA-1." Katagiri K., Maeda A., Shimonaka M., Kinashi T. Nat. Immunol. 4:741-748(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION IN INTEGRIN ACTIVATION, INTERACTION WITH RAP1A AND ITGAL, SUBCELLULAR LOCATION. |
| [3] | "RASSF3 is regulated by methylation in lung and breast tumor cell lines." Burbee D.G., White M.A., Minna J.D. Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lymph node. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Skin. |
| [9] | "The pro-apoptotic Ras effector Nore1 may serve as a Ras-regulated tumor suppressor in the lung." Vos M.D., Martinez A., Ellis C.A., Vallecorsa T., Clark G.J. J. Biol. Chem. 278:21938-21943(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS A TUMOR SUPPRESSOR, TISSUE SPECIFICITY. |
| [10] | "Regulation of the MST1 kinase by autophosphorylation, by the growth inhibitory proteins, RASSF1 and NORE1, and by Ras." Praskova M., Khoklatchev A., Ortiz-Vega S., Avruch J. Biochem. J. 381:453-462(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH STK4/MST1. |
| [11] | "Local activation of Rap1 contributes to directional vascular endothelial cell migration accompanied by extension of microtubules on which RAPL, a Rap1-associating molecule, localizes." Fujita H., Fukuhara S., Sakurai A., Yamagishi A., Kamioka Y., Nakaoka Y., Masuda M., Mochizuki N. J. Biol. Chem. 280:5022-5031(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN MICROTUBULE GROWTH REGULATION, SUBCELLULAR LOCATION, INTERACTION WITH RAP1A. |
| [12] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-352, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT THR-2 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-352, MASS SPECTROMETRY, CLEAVAGE OF INITIATOR METHIONINE. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF445801 mRNA. Translation: AAL38592.1. AY261332 mRNA. Translation: AAP83360.1. AY062002 mRNA. Translation: AAL40388.1. AY062003 mRNA. Translation: AAL40389.1. AY216268 mRNA. Translation: AAO61668.1. AK289861 mRNA. Translation: BAF82550.1. AL832784 mRNA. Translation: CAI46164.1. AL591846, AL354681 Genomic DNA. Translation: CAI13536.1. AL591846, AL354681 Genomic DNA. Translation: CAI13538.1. AL354681, AL591846 Genomic DNA. Translation: CAI15252.1. AL591846, AL354681 Genomic DNA. Translation: CAI13537.1. AL591846, AL354681 Genomic DNA. Translation: CAI13542.1. AL354681, AL591846 Genomic DNA. Translation: CAI15253.1. AL354681, AL591846 Genomic DNA. Translation: CAI15254.1. AL354681, AL591846 Genomic DNA. Translation: CAI15256.1. CH471100 Genomic DNA. Translation: EAW93544.1. BC004270 mRNA. Translation: AAH04270.1. Different initiation. BC007203 mRNA. Translation: AAH07203.1. Different initiation. BC042651 mRNA. Translation: AAH42651.1. |
| IPI | IPI00103528. IPI00179101. IPI00183637. IPI00332633. |
| RefSeq | NP_872604.1. NM_182663.2. NP_872605.1. NM_182664.2. NP_872606.1. NM_182665.2. |
| UniGene | Hs.497579. |
3D structure databases | |
| ProteinModelPortal | Q8WWW0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8WWW0. 26 interactions. |
| STRING | 9606.ENSP00000347443. |
PTM databases | |
| PhosphoSite | Q8WWW0. |
Polymorphism databases | |
| DMDM | 74751587. |
Proteomic databases | |
| PaxDb | Q8WWW0. |
| PRIDE | Q8WWW0. |
Protocols and materials databases | |
| DNASU | 83593. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000304534; ENSP00000306091; ENSG00000136653. ENST00000338603; ENSP00000342620; ENSG00000136653. ENST00000355294; ENSP00000347443; ENSG00000136653. ENST00000367117; ENSP00000356084; ENSG00000136653. ENST00000577571; ENSP00000462576; ENSG00000266094. ENST00000579436; ENSP00000462099; ENSG00000266094. ENST00000580449; ENSP00000462544; ENSG00000266094. ENST00000581503; ENSP00000464039; ENSG00000266094. |
| GeneID | 83593. |
| KEGG | hsa:83593. |
| UCSC | uc001hed.3. human. uc001hee.3. human. uc001hef.3. human. |
Organism-specific databases | |
| CTD | 83593. |
| GeneCards | GC01P206680. |
| HGNC | HGNC:17609. RASSF5. |
| HPA | CAB022664. |
| MIM | 607020. gene. |
| neXtProt | NX_Q8WWW0. |
| PharmGKB | PA134958571. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG308852. |
| HOGENOM | HOG000013025. |
| HOVERGEN | HBG054362. |
| InParanoid | Q8WWW0. |
| KO | K08015. |
| OMA | LTEYPLY. |
| OrthoDB | EOG4640C5. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | tcrpathway. TCR signaling in naive CD4+ T cells. cd8tcrpathway. TCR signaling in naive CD8+ T cells. |
| SignaLink | Q8WWW0. |
Gene expression databases | |
| ArrayExpress | Q8WWW0. |
| Bgee | Q8WWW0. |
| CleanEx | HS_RASSF5. |
| Genevestigator | Q8WWW0. |
| GermOnline | ENSG00000136653. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002219. Prot_Kinase_C-like_PE/DAG-bd. IPR000159. Ras-assoc. IPR011524. SARAH_dom. [Graphical view] |
| Pfam | PF00130. C1_1. 1 hit. PF00788. RA. 1 hit. [Graphical view] |
| SMART | SM00109. C1. 1 hit. SM00314. RA. 1 hit. [Graphical view] |
| PROSITE | PS50200. RA. 1 hit. PS50951. SARAH. 1 hit. PS00479. ZF_DAG_PE_1. 1 hit. PS50081. ZF_DAG_PE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 83593. |
| NextBio | 72517. |
| SOURCE | Search... |
Entry information
| Entry name | RASF5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WWW0 Secondary accession number(s): A8K1E6 Q9BT99 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
