SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WWV6

- FCAMR_HUMAN

UniProt

Q8WWV6 - FCAMR_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
Gene
FCAMR, FKSG87
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM.1 Publication

GO - Biological processi

  1. immune system process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Adaptive immunity, Immunity

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
Alternative name(s):
Fc alpha/mu receptor
CD_antigen: CD351
Gene namesi
Name:FCAMR
ORF Names:FKSG87
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:24692. FCAMR.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini17 – 450434Extracellular Reviewed prediction
Add
BLAST
Transmembranei451 – 47121Helical; Reviewed prediction
Add
BLAST
Topological domaini472 – 53261Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671773.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616 Reviewed prediction
Add
BLAST
Chaini17 – 532516High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
PRO_0000331483Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi82 ↔ 153 By similarity
Glycosylationi167 – 1671N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8WWV6.
PRIDEiQ8WWV6.

PTM databases

PhosphoSiteiQ8WWV6.

Expressioni

Tissue specificityi

Expressed by mesangial cells.1 Publication

Inductioni

Up-regulated by IFNG/IFN-gamma in mesangial cells.1 Publication

Gene expression databases

ArrayExpressiQ8WWV6.
BgeeiQ8WWV6.
CleanExiHS_FCAMR.
GenevestigatoriQ8WWV6.

Interactioni

Protein-protein interaction databases

BioGridi123827. 1 interaction.
IntActiQ8WWV6. 1 interaction.
STRINGi9606.ENSP00000383746.

Structurei

3D structure databases

ProteinModelPortaliQ8WWV6.
SMRiQ8WWV6. Positions 66-170.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini61 – 169109Ig-like V-type
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni75 – 9723Mediates immunoglobulin Fc fragment-binding By similarity
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG29699.
HOGENOMiHOG000112557.
HOVERGENiHBG107915.
KOiK16851.
OrthoDBiEOG7PCJG8.
PhylomeDBiQ8WWV6.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WWV6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPLFLILCLL QGSSFALPQK RPHPRWLWEG SLPSRTHLRA MGTLRPSSPL    50
CWREESSFAA PNSLKGSRLV SGEPGGAVTI QCHYAPSSVN RHQRKYWCRL 100
GPPRWICQTI VSTNQYTHHR YRDRVALTDF PQRGLFVVRL SQLSPDDIGC 150
YLCGIGSENN MLFLSMNLTI SAGPASTLPT ATPAAGELTM RSYGTASPVA 200
NRWTPGTTQT LGQGTAWDTV ASTPGTSKTT ASAEGRRTPG ATRPAAPGTG 250
SWAEGSVKAP APIPESPPSK SRSMSNTTEG VWEGTRSSVT NRARASKDRR 300
EMTTTKADRP REDIEGVRIA LDAAKKVLGT IGPPALVSET LAWEILPQAT 350
PVSKQQSQGS IGETTPAAGM WTLGTPAADV WILGTPAADV WTSMEAASGE 400
GSAAGDLDAA TGDRGPQATL SQTPAVGPWG PPGKESSVKR TFPEDESSSR 450
TLAPVSTMLA LFMLMALVLL QRKLWRRRTS QEAERVTLIQ MTHFLEVNPQ 500
ADQLPHVERK MLQDDSLPAG ASLTAPERNP GP 532
Length:532
Mass (Da):57,144
Last modified:March 1, 2002 - v1
Checksum:iD347A23C0F41EED3
GO
Isoform 2 (identifier: Q8WWV6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-220: GPASTLPTAT...LGQGTAWDTV → VLFQKMKAAL...GPLRRQKGSP
     221-532: Missing.

Note: No experimental confirmation available.

Show »
Length:220
Mass (Da):24,861
Checksum:iCF80B95E6D43E0EB
GO
Isoform 3 (identifier: Q8WWV6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGWPPDDPSPSFAA
     383-391: Missing.
     441-480: TFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTS → ATCPGLSTLKEIKVSAVLTQNPHSLLCVSAA

Note: No experimental confirmation available.

Show »
Length:534
Mass (Da):56,749
Checksum:i6EF8050E412AF91C
GO
Isoform 4 (identifier: Q8WWV6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-532: Missing.

Show »
Length:440
Mass (Da):46,749
Checksum:iA2F4EADB47483D25
GO

Sequence cautioni

The sequence AAI09264.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence AAI09265.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1111MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGW PPDDPSPSFAA in isoform 3.
VSP_033227Add
BLAST
Alternative sequencei173 – 22048GPAST…AWDTV → VLFQKMKAALGPWLLSLPCW PCLCLWLWFYCKGSSGEGGP LRRQKGSP in isoform 2.
VSP_033228Add
BLAST
Alternative sequencei221 – 532312Missing in isoform 2.
VSP_033229Add
BLAST
Alternative sequencei383 – 3919Missing in isoform 3.
VSP_033230
Alternative sequencei441 – 53292Missing in isoform 4.
VSP_033231Add
BLAST
Alternative sequencei441 – 48040TFPED…RRRTS → ATCPGLSTLKEIKVSAVLTQ NPHSLLCVSAA in isoform 3.
VSP_033232Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
E15470 mRNA. No translation available.
AY063125 mRNA. Translation: AAL51154.1.
AY063126 mRNA. Translation: AAL51155.1.
AF354295 mRNA. Translation: AAK39522.1.
BC109263 mRNA. Translation: AAI09264.1. Different initiation.
BC109264 mRNA. Translation: AAI09265.1. Different initiation.
RefSeqiNP_001116451.1. NM_001122979.2.
NP_114418.2. NM_032029.4.
UniGeneiHs.145519.

Genome annotation databases

EnsembliENST00000400962; ENSP00000383746; ENSG00000162897.
ENST00000450945; ENSP00000392707; ENSG00000162897.
GeneIDi83953.
KEGGihsa:83953.
UCSCiuc001hfa.4. human. [Q8WWV6-1]
uc001hfb.3. human. [Q8WWV6-2]

Polymorphism databases

DMDMi74760589.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
E15470 mRNA. No translation available.
AY063125 mRNA. Translation: AAL51154.1 .
AY063126 mRNA. Translation: AAL51155.1 .
AF354295 mRNA. Translation: AAK39522.1 .
BC109263 mRNA. Translation: AAI09264.1 . Different initiation.
BC109264 mRNA. Translation: AAI09265.1 . Different initiation.
RefSeqi NP_001116451.1. NM_001122979.2.
NP_114418.2. NM_032029.4.
UniGenei Hs.145519.

3D structure databases

ProteinModelPortali Q8WWV6.
SMRi Q8WWV6. Positions 66-170.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123827. 1 interaction.
IntActi Q8WWV6. 1 interaction.
STRINGi 9606.ENSP00000383746.

PTM databases

PhosphoSitei Q8WWV6.

Polymorphism databases

DMDMi 74760589.

Proteomic databases

PaxDbi Q8WWV6.
PRIDEi Q8WWV6.

Protocols and materials databases

DNASUi 83953.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000400962 ; ENSP00000383746 ; ENSG00000162897 .
ENST00000450945 ; ENSP00000392707 ; ENSG00000162897 .
GeneIDi 83953.
KEGGi hsa:83953.
UCSCi uc001hfa.4. human. [Q8WWV6-1 ]
uc001hfb.3. human. [Q8WWV6-2 ]

Organism-specific databases

CTDi 83953.
GeneCardsi GC01M207131.
HGNCi HGNC:24692. FCAMR.
MIMi 605484. gene.
neXtProti NX_Q8WWV6.
PharmGKBi PA142671773.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG29699.
HOGENOMi HOG000112557.
HOVERGENi HBG107915.
KOi K16851.
OrthoDBi EOG7PCJG8.
PhylomeDBi Q8WWV6.

Miscellaneous databases

GenomeRNAii 83953.
NextBioi 73089.
PROi Q8WWV6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8WWV6.
Bgeei Q8WWV6.
CleanExi HS_FCAMR.
Genevestigatori Q8WWV6.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view ]
Pfami PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Lymph node.
  2. "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy."
    McDonald K.J., Cameron A.J.M., Allen J.M., Jardine A.G.
    Biochem. Biophys. Res. Commun. 290:438-442(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 303-532 (ISOFORM 4), FUNCTION, GLYCOSYLATION, TISSUE SPECIFICITY, INDUCTION BY IFNG.
  3. "Molecular cloning and characterization of FKSG87, a novel gene located on human chromosome 1."
    Wang Y.-G., Gong L.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiFCAMR_HUMAN
AccessioniPrimary (citable) accession number: Q8WWV6
Secondary accession number(s): Q32M82, Q8WWV5, Q96SA2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: April 16, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi