Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WWV6

- FCAMR_HUMAN

UniProt

Q8WWV6 - FCAMR_HUMAN

Protein

High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor

Gene

FCAMR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 1 (01 Mar 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM.1 Publication

    GO - Biological processi

    1. immune system process Source: UniProtKB-KW

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Adaptive immunity, Immunity

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
    Alternative name(s):
    Fc alpha/mu receptor
    CD_antigen: CD351
    Gene namesi
    Name:FCAMR
    ORF Names:FKSG87
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:24692. FCAMR.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671773.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1616Sequence AnalysisAdd
    BLAST
    Chaini17 – 532516High affinity immunoglobulin alpha and immunoglobulin mu Fc receptorPRO_0000331483Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi82 ↔ 153PROSITE-ProRule annotation
    Glycosylationi167 – 1671N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    N-glycosylated.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ8WWV6.
    PRIDEiQ8WWV6.

    PTM databases

    PhosphoSiteiQ8WWV6.

    Expressioni

    Tissue specificityi

    Expressed by mesangial cells.1 Publication

    Inductioni

    Up-regulated by IFNG/IFN-gamma in mesangial cells.1 Publication

    Gene expression databases

    ArrayExpressiQ8WWV6.
    BgeeiQ8WWV6.
    CleanExiHS_FCAMR.
    GenevestigatoriQ8WWV6.

    Interactioni

    Protein-protein interaction databases

    BioGridi123827. 1 interaction.
    IntActiQ8WWV6. 1 interaction.
    STRINGi9606.ENSP00000383746.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8WWV6.
    SMRiQ8WWV6. Positions 66-170.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini17 – 450434ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini472 – 53261CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei451 – 47121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini61 – 169109Ig-like V-typeAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni75 – 9723Mediates immunoglobulin Fc fragment-bindingBy similarityAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG29699.
    HOGENOMiHOG000112557.
    HOVERGENiHBG107915.
    KOiK16851.
    OrthoDBiEOG7PCJG8.
    PhylomeDBiQ8WWV6.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view]
    PfamiPF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8WWV6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPLFLILCLL QGSSFALPQK RPHPRWLWEG SLPSRTHLRA MGTLRPSSPL    50
    CWREESSFAA PNSLKGSRLV SGEPGGAVTI QCHYAPSSVN RHQRKYWCRL 100
    GPPRWICQTI VSTNQYTHHR YRDRVALTDF PQRGLFVVRL SQLSPDDIGC 150
    YLCGIGSENN MLFLSMNLTI SAGPASTLPT ATPAAGELTM RSYGTASPVA 200
    NRWTPGTTQT LGQGTAWDTV ASTPGTSKTT ASAEGRRTPG ATRPAAPGTG 250
    SWAEGSVKAP APIPESPPSK SRSMSNTTEG VWEGTRSSVT NRARASKDRR 300
    EMTTTKADRP REDIEGVRIA LDAAKKVLGT IGPPALVSET LAWEILPQAT 350
    PVSKQQSQGS IGETTPAAGM WTLGTPAADV WILGTPAADV WTSMEAASGE 400
    GSAAGDLDAA TGDRGPQATL SQTPAVGPWG PPGKESSVKR TFPEDESSSR 450
    TLAPVSTMLA LFMLMALVLL QRKLWRRRTS QEAERVTLIQ MTHFLEVNPQ 500
    ADQLPHVERK MLQDDSLPAG ASLTAPERNP GP 532
    Length:532
    Mass (Da):57,144
    Last modified:March 1, 2002 - v1
    Checksum:iD347A23C0F41EED3
    GO
    Isoform 2 (identifier: Q8WWV6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         173-220: GPASTLPTAT...LGQGTAWDTV → VLFQKMKAAL...GPLRRQKGSP
         221-532: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:220
    Mass (Da):24,861
    Checksum:iCF80B95E6D43E0EB
    GO
    Isoform 3 (identifier: Q8WWV6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGWPPDDPSPSFAA
         383-391: Missing.
         441-480: TFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTS → ATCPGLSTLKEIKVSAVLTQNPHSLLCVSAA

    Note: No experimental confirmation available.

    Show »
    Length:534
    Mass (Da):56,749
    Checksum:i6EF8050E412AF91C
    GO
    Isoform 4 (identifier: Q8WWV6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         441-532: Missing.

    Show »
    Length:440
    Mass (Da):46,749
    Checksum:iA2F4EADB47483D25
    GO

    Sequence cautioni

    The sequence AAI09264.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAI09265.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1111MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGW PPDDPSPSFAA in isoform 3. 1 PublicationVSP_033227Add
    BLAST
    Alternative sequencei173 – 22048GPAST…AWDTV → VLFQKMKAALGPWLLSLPCW PCLCLWLWFYCKGSSGEGGP LRRQKGSP in isoform 2. 1 PublicationVSP_033228Add
    BLAST
    Alternative sequencei221 – 532312Missing in isoform 2. 1 PublicationVSP_033229Add
    BLAST
    Alternative sequencei383 – 3919Missing in isoform 3. 1 PublicationVSP_033230
    Alternative sequencei441 – 53292Missing in isoform 4. 1 PublicationVSP_033231Add
    BLAST
    Alternative sequencei441 – 48040TFPED…RRRTS → ATCPGLSTLKEIKVSAVLTQ NPHSLLCVSAA in isoform 3. 1 PublicationVSP_033232Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    E15470 mRNA. No translation available.
    AY063125 mRNA. Translation: AAL51154.1.
    AY063126 mRNA. Translation: AAL51155.1.
    AF354295 mRNA. Translation: AAK39522.1.
    BC109263 mRNA. Translation: AAI09264.1. Different initiation.
    BC109264 mRNA. Translation: AAI09265.1. Different initiation.
    RefSeqiNP_001116451.1. NM_001122979.2.
    NP_114418.2. NM_032029.4.
    UniGeneiHs.145519.

    Genome annotation databases

    EnsembliENST00000400962; ENSP00000383746; ENSG00000162897.
    ENST00000450945; ENSP00000392707; ENSG00000162897.
    GeneIDi83953.
    KEGGihsa:83953.
    UCSCiuc001hfa.4. human. [Q8WWV6-1]
    uc001hfb.3. human. [Q8WWV6-2]

    Polymorphism databases

    DMDMi74760589.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    E15470 mRNA. No translation available.
    AY063125 mRNA. Translation: AAL51154.1 .
    AY063126 mRNA. Translation: AAL51155.1 .
    AF354295 mRNA. Translation: AAK39522.1 .
    BC109263 mRNA. Translation: AAI09264.1 . Different initiation.
    BC109264 mRNA. Translation: AAI09265.1 . Different initiation.
    RefSeqi NP_001116451.1. NM_001122979.2.
    NP_114418.2. NM_032029.4.
    UniGenei Hs.145519.

    3D structure databases

    ProteinModelPortali Q8WWV6.
    SMRi Q8WWV6. Positions 66-170.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123827. 1 interaction.
    IntActi Q8WWV6. 1 interaction.
    STRINGi 9606.ENSP00000383746.

    PTM databases

    PhosphoSitei Q8WWV6.

    Polymorphism databases

    DMDMi 74760589.

    Proteomic databases

    PaxDbi Q8WWV6.
    PRIDEi Q8WWV6.

    Protocols and materials databases

    DNASUi 83953.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000400962 ; ENSP00000383746 ; ENSG00000162897 .
    ENST00000450945 ; ENSP00000392707 ; ENSG00000162897 .
    GeneIDi 83953.
    KEGGi hsa:83953.
    UCSCi uc001hfa.4. human. [Q8WWV6-1 ]
    uc001hfb.3. human. [Q8WWV6-2 ]

    Organism-specific databases

    CTDi 83953.
    GeneCardsi GC01M207131.
    HGNCi HGNC:24692. FCAMR.
    MIMi 605484. gene.
    neXtProti NX_Q8WWV6.
    PharmGKBi PA142671773.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG29699.
    HOGENOMi HOG000112557.
    HOVERGENi HBG107915.
    KOi K16851.
    OrthoDBi EOG7PCJG8.
    PhylomeDBi Q8WWV6.

    Miscellaneous databases

    GenomeRNAii 83953.
    NextBioi 73089.
    PROi Q8WWV6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8WWV6.
    Bgeei Q8WWV6.
    CleanExi HS_FCAMR.
    Genevestigatori Q8WWV6.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view ]
    Pfami PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Lymph node.
    2. "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy."
      McDonald K.J., Cameron A.J.M., Allen J.M., Jardine A.G.
      Biochem. Biophys. Res. Commun. 290:438-442(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 303-532 (ISOFORM 4), FUNCTION, GLYCOSYLATION, TISSUE SPECIFICITY, INDUCTION BY IFNG.
    3. "Molecular cloning and characterization of FKSG87, a novel gene located on human chromosome 1."
      Wang Y.-G., Gong L.
      Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

    Entry informationi

    Entry nameiFCAMR_HUMAN
    AccessioniPrimary (citable) accession number: Q8WWV6
    Secondary accession number(s): Q32M82, Q8WWV5, Q96SA2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 29, 2008
    Last sequence update: March 1, 2002
    Last modified: October 1, 2014
    This is version 87 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3