Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8WWV6 (FCAMR_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
Alternative name(s):
Fc alpha/mu receptor
CD_antigen=CD351
Gene names
Name:FCAMR
ORF Names:FKSG87
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length532 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM. Ref.2

Subcellular location

Cell membrane; Single-pass type I membrane protein By similarity.

Tissue specificity

Expressed by mesangial cells. Ref.2

Induction

Up-regulated by IFNG/IFN-gamma in mesangial cells. Ref.2

Post-translational modification

N-glycosylated. Ref.2

Sequence similarities

Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Sequence caution

The sequence AAI09264.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence AAI09265.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Biological processAdaptive immunity
Immunity
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Signal
Transmembrane
Transmembrane helix
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processimmune system process

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8WWV6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8WWV6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     173-220: GPASTLPTAT...LGQGTAWDTV → VLFQKMKAAL...GPLRRQKGSP
     221-532: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8WWV6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGWPPDDPSPSFAA
     383-391: Missing.
     441-480: TFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTS → ATCPGLSTLKEIKVSAVLTQNPHSLLCVSAA
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8WWV6-4)

The sequence of this isoform differs from the canonical sequence as follows:
     441-532: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1616 Potential
Chain17 – 532516High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
PRO_0000331483

Regions

Topological domain17 – 450434Extracellular Potential
Transmembrane451 – 47121Helical; Potential
Topological domain472 – 53261Cytoplasmic Potential
Domain61 – 169109Ig-like V-type
Region75 – 9723Mediates immunoglobulin Fc fragment-binding By similarity

Amino acid modifications

Glycosylation1671N-linked (GlcNAc...) Potential
Disulfide bond82 ↔ 153 By similarity

Natural variations

Alternative sequence1 – 1111MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGW PPDDPSPSFAA in isoform 3.
VSP_033227
Alternative sequence173 – 22048GPAST…AWDTV → VLFQKMKAALGPWLLSLPCW PCLCLWLWFYCKGSSGEGGP LRRQKGSP in isoform 2.
VSP_033228
Alternative sequence221 – 532312Missing in isoform 2.
VSP_033229
Alternative sequence383 – 3919Missing in isoform 3.
VSP_033230
Alternative sequence441 – 53292Missing in isoform 4.
VSP_033231
Alternative sequence441 – 48040TFPED…RRRTS → ATCPGLSTLKEIKVSAVLTQ NPHSLLCVSAA in isoform 3.
VSP_033232

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2002. Version 1.
Checksum: D347A23C0F41EED3

FASTA53257,144
        10         20         30         40         50         60 
MPLFLILCLL QGSSFALPQK RPHPRWLWEG SLPSRTHLRA MGTLRPSSPL CWREESSFAA 

        70         80         90        100        110        120 
PNSLKGSRLV SGEPGGAVTI QCHYAPSSVN RHQRKYWCRL GPPRWICQTI VSTNQYTHHR 

       130        140        150        160        170        180 
YRDRVALTDF PQRGLFVVRL SQLSPDDIGC YLCGIGSENN MLFLSMNLTI SAGPASTLPT 

       190        200        210        220        230        240 
ATPAAGELTM RSYGTASPVA NRWTPGTTQT LGQGTAWDTV ASTPGTSKTT ASAEGRRTPG 

       250        260        270        280        290        300 
ATRPAAPGTG SWAEGSVKAP APIPESPPSK SRSMSNTTEG VWEGTRSSVT NRARASKDRR 

       310        320        330        340        350        360 
EMTTTKADRP REDIEGVRIA LDAAKKVLGT IGPPALVSET LAWEILPQAT PVSKQQSQGS 

       370        380        390        400        410        420 
IGETTPAAGM WTLGTPAADV WILGTPAADV WTSMEAASGE GSAAGDLDAA TGDRGPQATL 

       430        440        450        460        470        480 
SQTPAVGPWG PPGKESSVKR TFPEDESSSR TLAPVSTMLA LFMLMALVLL QRKLWRRRTS 

       490        500        510        520        530 
QEAERVTLIQ MTHFLEVNPQ ADQLPHVERK MLQDDSLPAG ASLTAPERNP GP 

« Hide

Isoform 2 [UniParc].

Checksum: CF80B95E6D43E0EB
Show »

FASTA22024,861
Isoform 3 [UniParc].

Checksum: 6EF8050E412AF91C
Show »

FASTA53456,749
Isoform 4 [UniParc].

Checksum: A2F4EADB47483D25
Show »

FASTA44046,749

References

« Hide 'large scale' references
[1]"Fc alpha/mu receptor mediates endocytosis of IgM-coated microbes."
Shibuya A., Sakamoto N., Shimizu Y., Shibuya K., Osawa M., Hiroyama T., Eyre H.J., Sutherland G.R., Endo Y., Fujita T., Miyabayashi T., Sakano S., Tsuji T., Nakayama E., Phillips J.H., Lanier L.L., Nakauchi H.
Nat. Immunol. 1:441-446(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Lymph node.
[2]"Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy."
McDonald K.J., Cameron A.J.M., Allen J.M., Jardine A.G.
Biochem. Biophys. Res. Commun. 290:438-442(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 303-532 (ISOFORM 4), FUNCTION, GLYCOSYLATION, TISSUE SPECIFICITY, INDUCTION BY IFNG.
[3]"Molecular cloning and characterization of FKSG87, a novel gene located on human chromosome 1."
Wang Y.-G., Gong L.
Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
E15470 mRNA. No translation available.
AY063125 mRNA. Translation: AAL51154.1.
AY063126 mRNA. Translation: AAL51155.1.
AF354295 mRNA. Translation: AAK39522.1.
BC109263 mRNA. Translation: AAI09264.1. Different initiation.
BC109264 mRNA. Translation: AAI09265.1. Different initiation.
RefSeqNP_001116451.1. NM_001122979.2.
NP_114418.2. NM_032029.4.
UniGeneHs.145519.

3D structure databases

ProteinModelPortalQ8WWV6.
SMRQ8WWV6. Positions 66-170.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123827. 1 interaction.
IntActQ8WWV6. 1 interaction.
STRING9606.ENSP00000383746.

PTM databases

PhosphoSiteQ8WWV6.

Polymorphism databases

DMDM74760589.

Proteomic databases

PaxDbQ8WWV6.
PRIDEQ8WWV6.

Protocols and materials databases

DNASU83953.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000400962; ENSP00000383746; ENSG00000162897.
ENST00000450945; ENSP00000392707; ENSG00000162897.
GeneID83953.
KEGGhsa:83953.
UCSCuc001hfa.4. human. [Q8WWV6-1]
uc001hfb.3. human. [Q8WWV6-2]

Organism-specific databases

CTD83953.
GeneCardsGC01M207131.
HGNCHGNC:24692. FCAMR.
MIM605484. gene.
neXtProtNX_Q8WWV6.
PharmGKBPA142671773.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG29699.
HOGENOMHOG000112557.
HOVERGENHBG107915.
KOK16851.
OrthoDBEOG7PCJG8.
PhylomeDBQ8WWV6.

Gene expression databases

ArrayExpressQ8WWV6.
BgeeQ8WWV6.
CleanExHS_FCAMR.
GenevestigatorQ8WWV6.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
InterProIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamPF07686. V-set. 1 hit.
[Graphical view]
SMARTSM00409. IG. 1 hit.
[Graphical view]
PROSITEPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi83953.
NextBio73089.
PROQ8WWV6.
SOURCESearch...

Entry information

Entry nameFCAMR_HUMAN
AccessionPrimary (citable) accession number: Q8WWV6
Secondary accession number(s): Q32M82, Q8WWV5, Q96SA2
Entry history
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: April 16, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries