Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor

Gene

FCAMR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Adaptive immunity, Immunity

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
Alternative name(s):
Fc alpha/mu receptor
CD_antigen: CD351
Gene namesi
Name:FCAMR
ORF Names:FKSG87
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:24692. FCAMR.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini17 – 450434ExtracellularSequence AnalysisAdd
BLAST
Transmembranei451 – 47121HelicalSequence AnalysisAdd
BLAST
Topological domaini472 – 53261CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671773.

Polymorphism and mutation databases

BioMutaiFCAMR.
DMDMi74760589.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence AnalysisAdd
BLAST
Chaini17 – 532516High affinity immunoglobulin alpha and immunoglobulin mu Fc receptorPRO_0000331483Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi82 ↔ 153PROSITE-ProRule annotation
Glycosylationi167 – 1671N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8WWV6.
PRIDEiQ8WWV6.

PTM databases

PhosphoSiteiQ8WWV6.

Expressioni

Tissue specificityi

Expressed by mesangial cells.1 Publication

Inductioni

Up-regulated by IFNG/IFN-gamma in mesangial cells.1 Publication

Gene expression databases

BgeeiQ8WWV6.
CleanExiHS_FCAMR.
ExpressionAtlasiQ8WWV6. baseline and differential.
GenevestigatoriQ8WWV6.

Interactioni

Protein-protein interaction databases

BioGridi123827. 1 interaction.
IntActiQ8WWV6. 1 interaction.
STRINGi9606.ENSP00000383746.

Structurei

3D structure databases

ProteinModelPortaliQ8WWV6.
SMRiQ8WWV6. Positions 66-170.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini61 – 169109Ig-like V-typeAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni75 – 9723Mediates immunoglobulin Fc fragment-bindingBy similarityAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG29699.
HOGENOMiHOG000112557.
HOVERGENiHBG107915.
InParanoidiQ8WWV6.
KOiK16851.
OrthoDBiEOG7PCJG8.
PhylomeDBiQ8WWV6.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WWV6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLFLILCLL QGSSFALPQK RPHPRWLWEG SLPSRTHLRA MGTLRPSSPL
60 70 80 90 100
CWREESSFAA PNSLKGSRLV SGEPGGAVTI QCHYAPSSVN RHQRKYWCRL
110 120 130 140 150
GPPRWICQTI VSTNQYTHHR YRDRVALTDF PQRGLFVVRL SQLSPDDIGC
160 170 180 190 200
YLCGIGSENN MLFLSMNLTI SAGPASTLPT ATPAAGELTM RSYGTASPVA
210 220 230 240 250
NRWTPGTTQT LGQGTAWDTV ASTPGTSKTT ASAEGRRTPG ATRPAAPGTG
260 270 280 290 300
SWAEGSVKAP APIPESPPSK SRSMSNTTEG VWEGTRSSVT NRARASKDRR
310 320 330 340 350
EMTTTKADRP REDIEGVRIA LDAAKKVLGT IGPPALVSET LAWEILPQAT
360 370 380 390 400
PVSKQQSQGS IGETTPAAGM WTLGTPAADV WILGTPAADV WTSMEAASGE
410 420 430 440 450
GSAAGDLDAA TGDRGPQATL SQTPAVGPWG PPGKESSVKR TFPEDESSSR
460 470 480 490 500
TLAPVSTMLA LFMLMALVLL QRKLWRRRTS QEAERVTLIQ MTHFLEVNPQ
510 520 530
ADQLPHVERK MLQDDSLPAG ASLTAPERNP GP
Length:532
Mass (Da):57,144
Last modified:March 1, 2002 - v1
Checksum:iD347A23C0F41EED3
GO
Isoform 2 (identifier: Q8WWV6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-220: GPASTLPTAT...LGQGTAWDTV → VLFQKMKAAL...GPLRRQKGSP
     221-532: Missing.

Note: No experimental confirmation available.

Show »
Length:220
Mass (Da):24,861
Checksum:iCF80B95E6D43E0EB
GO
Isoform 3 (identifier: Q8WWV6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGWPPDDPSPSFAA
     383-391: Missing.
     441-480: TFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTS → ATCPGLSTLKEIKVSAVLTQNPHSLLCVSAA

Note: No experimental confirmation available.

Show »
Length:534
Mass (Da):56,749
Checksum:i6EF8050E412AF91C
GO
Isoform 4 (identifier: Q8WWV6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-532: Missing.

Show »
Length:440
Mass (Da):46,749
Checksum:iA2F4EADB47483D25
GO

Sequence cautioni

The sequence AAI09264.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAI09265.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1111MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGW PPDDPSPSFAA in isoform 3. 1 PublicationVSP_033227Add
BLAST
Alternative sequencei173 – 22048GPAST…AWDTV → VLFQKMKAALGPWLLSLPCW PCLCLWLWFYCKGSSGEGGP LRRQKGSP in isoform 2. 1 PublicationVSP_033228Add
BLAST
Alternative sequencei221 – 532312Missing in isoform 2. 1 PublicationVSP_033229Add
BLAST
Alternative sequencei383 – 3919Missing in isoform 3. 1 PublicationVSP_033230
Alternative sequencei441 – 53292Missing in isoform 4. 1 PublicationVSP_033231Add
BLAST
Alternative sequencei441 – 48040TFPED…RRRTS → ATCPGLSTLKEIKVSAVLTQ NPHSLLCVSAA in isoform 3. 1 PublicationVSP_033232Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
E15470 mRNA. No translation available.
AY063125 mRNA. Translation: AAL51154.1.
AY063126 mRNA. Translation: AAL51155.1.
AF354295 mRNA. Translation: AAK39522.1.
BC109263 mRNA. Translation: AAI09264.1. Different initiation.
BC109264 mRNA. Translation: AAI09265.1. Different initiation.
RefSeqiNP_001116451.1. NM_001122979.2.
NP_114418.2. NM_032029.4.
UniGeneiHs.145519.

Genome annotation databases

EnsembliENST00000400962; ENSP00000383746; ENSG00000162897.
ENST00000450945; ENSP00000392707; ENSG00000162897.
GeneIDi83953.
KEGGihsa:83953.
UCSCiuc001hfa.4. human. [Q8WWV6-1]
uc001hfb.3. human. [Q8WWV6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
E15470 mRNA. No translation available.
AY063125 mRNA. Translation: AAL51154.1.
AY063126 mRNA. Translation: AAL51155.1.
AF354295 mRNA. Translation: AAK39522.1.
BC109263 mRNA. Translation: AAI09264.1. Different initiation.
BC109264 mRNA. Translation: AAI09265.1. Different initiation.
RefSeqiNP_001116451.1. NM_001122979.2.
NP_114418.2. NM_032029.4.
UniGeneiHs.145519.

3D structure databases

ProteinModelPortaliQ8WWV6.
SMRiQ8WWV6. Positions 66-170.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123827. 1 interaction.
IntActiQ8WWV6. 1 interaction.
STRINGi9606.ENSP00000383746.

PTM databases

PhosphoSiteiQ8WWV6.

Polymorphism and mutation databases

BioMutaiFCAMR.
DMDMi74760589.

Proteomic databases

PaxDbiQ8WWV6.
PRIDEiQ8WWV6.

Protocols and materials databases

DNASUi83953.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000400962; ENSP00000383746; ENSG00000162897.
ENST00000450945; ENSP00000392707; ENSG00000162897.
GeneIDi83953.
KEGGihsa:83953.
UCSCiuc001hfa.4. human. [Q8WWV6-1]
uc001hfb.3. human. [Q8WWV6-2]

Organism-specific databases

CTDi83953.
GeneCardsiGC01M207131.
HGNCiHGNC:24692. FCAMR.
MIMi605484. gene.
neXtProtiNX_Q8WWV6.
PharmGKBiPA142671773.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG29699.
HOGENOMiHOG000112557.
HOVERGENiHBG107915.
InParanoidiQ8WWV6.
KOiK16851.
OrthoDBiEOG7PCJG8.
PhylomeDBiQ8WWV6.

Miscellaneous databases

GenomeRNAii83953.
NextBioi73089.
PROiQ8WWV6.
SOURCEiSearch...

Gene expression databases

BgeeiQ8WWV6.
CleanExiHS_FCAMR.
ExpressionAtlasiQ8WWV6. baseline and differential.
GenevestigatoriQ8WWV6.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Lymph node.
  2. "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy."
    McDonald K.J., Cameron A.J.M., Allen J.M., Jardine A.G.
    Biochem. Biophys. Res. Commun. 290:438-442(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 303-532 (ISOFORM 4), FUNCTION, GLYCOSYLATION, TISSUE SPECIFICITY, INDUCTION BY IFNG.
  3. "Molecular cloning and characterization of FKSG87, a novel gene located on human chromosome 1."
    Wang Y.-G., Gong L.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).

Entry informationi

Entry nameiFCAMR_HUMAN
AccessioniPrimary (citable) accession number: Q8WWV6
Secondary accession number(s): Q32M82, Q8WWV5, Q96SA2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: April 29, 2015
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.