Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor

Gene

FCAMR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Adaptive immunity, Immunity

Enzyme and pathway databases

BioCyciZFISH:ENSG00000162897-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
Alternative name(s):
Fc alpha/mu receptor
CD_antigen: CD351
Gene namesi
Name:FCAMR
ORF Names:FKSG87
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:24692. FCAMR.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini17 – 450ExtracellularSequence analysisAdd BLAST434
Transmembranei451 – 471HelicalSequence analysisAdd BLAST21
Topological domaini472 – 532CytoplasmicSequence analysisAdd BLAST61

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi83953.
PharmGKBiPA142671773.

Polymorphism and mutation databases

BioMutaiFCAMR.
DMDMi74760589.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
ChainiPRO_000033148317 – 532High affinity immunoglobulin alpha and immunoglobulin mu Fc receptorAdd BLAST516

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi82 ↔ 153PROSITE-ProRule annotation
Glycosylationi167N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8WWV6.
PeptideAtlasiQ8WWV6.
PRIDEiQ8WWV6.

PTM databases

iPTMnetiQ8WWV6.
PhosphoSitePlusiQ8WWV6.

Expressioni

Tissue specificityi

Expressed by mesangial cells.1 Publication

Inductioni

Up-regulated by IFNG/IFN-gamma in mesangial cells.1 Publication

Gene expression databases

BgeeiENSG00000162897.
CleanExiHS_FCAMR.
ExpressionAtlasiQ8WWV6. baseline and differential.
GenevisibleiQ8WWV6. HS.

Interactioni

Protein-protein interaction databases

BioGridi123827. 1 interactor.
IntActiQ8WWV6. 1 interactor.
STRINGi9606.ENSP00000316491.

Structurei

3D structure databases

ProteinModelPortaliQ8WWV6.
SMRiQ8WWV6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini61 – 169Ig-like V-typeAdd BLAST109

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni75 – 97Mediates immunoglobulin Fc fragment-bindingBy similarityAdd BLAST23

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJ8T. Eukaryota.
ENOG41114ND. LUCA.
HOGENOMiHOG000112557.
HOVERGENiHBG107915.
InParanoidiQ8WWV6.
KOiK16851.
PhylomeDBiQ8WWV6.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WWV6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLFLILCLL QGSSFALPQK RPHPRWLWEG SLPSRTHLRA MGTLRPSSPL
60 70 80 90 100
CWREESSFAA PNSLKGSRLV SGEPGGAVTI QCHYAPSSVN RHQRKYWCRL
110 120 130 140 150
GPPRWICQTI VSTNQYTHHR YRDRVALTDF PQRGLFVVRL SQLSPDDIGC
160 170 180 190 200
YLCGIGSENN MLFLSMNLTI SAGPASTLPT ATPAAGELTM RSYGTASPVA
210 220 230 240 250
NRWTPGTTQT LGQGTAWDTV ASTPGTSKTT ASAEGRRTPG ATRPAAPGTG
260 270 280 290 300
SWAEGSVKAP APIPESPPSK SRSMSNTTEG VWEGTRSSVT NRARASKDRR
310 320 330 340 350
EMTTTKADRP REDIEGVRIA LDAAKKVLGT IGPPALVSET LAWEILPQAT
360 370 380 390 400
PVSKQQSQGS IGETTPAAGM WTLGTPAADV WILGTPAADV WTSMEAASGE
410 420 430 440 450
GSAAGDLDAA TGDRGPQATL SQTPAVGPWG PPGKESSVKR TFPEDESSSR
460 470 480 490 500
TLAPVSTMLA LFMLMALVLL QRKLWRRRTS QEAERVTLIQ MTHFLEVNPQ
510 520 530
ADQLPHVERK MLQDDSLPAG ASLTAPERNP GP
Length:532
Mass (Da):57,144
Last modified:March 1, 2002 - v1
Checksum:iD347A23C0F41EED3
GO
Isoform 2 (identifier: Q8WWV6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-220: GPASTLPTAT...LGQGTAWDTV → VLFQKMKAAL...GPLRRQKGSP
     221-532: Missing.

Note: No experimental confirmation available.
Show »
Length:220
Mass (Da):24,861
Checksum:iCF80B95E6D43E0EB
GO
Isoform 3 (identifier: Q8WWV6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGWPPDDPSPSFAA
     383-391: Missing.
     441-480: TFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTS → ATCPGLSTLKEIKVSAVLTQNPHSLLCVSAA

Note: No experimental confirmation available.
Show »
Length:534
Mass (Da):56,749
Checksum:i6EF8050E412AF91C
GO
Isoform 4 (identifier: Q8WWV6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-532: Missing.

Show »
Length:440
Mass (Da):46,749
Checksum:iA2F4EADB47483D25
GO

Sequence cautioni

The sequence AAI09264 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAI09265 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0332271 – 11MPLFLILCLLQ → MDGEATVKPGEQVPLWTHGW PPDDPSPSFAA in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_033228173 – 220GPAST…AWDTV → VLFQKMKAALGPWLLSLPCW PCLCLWLWFYCKGSSGEGGP LRRQKGSP in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_033229221 – 532Missing in isoform 2. 1 PublicationAdd BLAST312
Alternative sequenceiVSP_033230383 – 391Missing in isoform 3. 1 Publication9
Alternative sequenceiVSP_033231441 – 532Missing in isoform 4. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_033232441 – 480TFPED…RRRTS → ATCPGLSTLKEIKVSAVLTQ NPHSLLCVSAA in isoform 3. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
E15470 mRNA. No translation available.
AY063125 mRNA. Translation: AAL51154.1.
AY063126 mRNA. Translation: AAL51155.1.
AF354295 mRNA. Translation: AAK39522.1.
BC109263 mRNA. Translation: AAI09264.1. Different initiation.
BC109264 mRNA. Translation: AAI09265.1. Different initiation.
RefSeqiNP_001116451.1. NM_001122979.2.
NP_114418.2. NM_032029.4.
UniGeneiHs.145519.

Genome annotation databases

EnsembliENST00000400962; ENSP00000383746; ENSG00000162897.
ENST00000450945; ENSP00000392707; ENSG00000162897.
GeneIDi83953.
KEGGihsa:83953.
UCSCiuc001hfb.3. human. [Q8WWV6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
E15470 mRNA. No translation available.
AY063125 mRNA. Translation: AAL51154.1.
AY063126 mRNA. Translation: AAL51155.1.
AF354295 mRNA. Translation: AAK39522.1.
BC109263 mRNA. Translation: AAI09264.1. Different initiation.
BC109264 mRNA. Translation: AAI09265.1. Different initiation.
RefSeqiNP_001116451.1. NM_001122979.2.
NP_114418.2. NM_032029.4.
UniGeneiHs.145519.

3D structure databases

ProteinModelPortaliQ8WWV6.
SMRiQ8WWV6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123827. 1 interactor.
IntActiQ8WWV6. 1 interactor.
STRINGi9606.ENSP00000316491.

PTM databases

iPTMnetiQ8WWV6.
PhosphoSitePlusiQ8WWV6.

Polymorphism and mutation databases

BioMutaiFCAMR.
DMDMi74760589.

Proteomic databases

PaxDbiQ8WWV6.
PeptideAtlasiQ8WWV6.
PRIDEiQ8WWV6.

Protocols and materials databases

DNASUi83953.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000400962; ENSP00000383746; ENSG00000162897.
ENST00000450945; ENSP00000392707; ENSG00000162897.
GeneIDi83953.
KEGGihsa:83953.
UCSCiuc001hfb.3. human. [Q8WWV6-1]

Organism-specific databases

CTDi83953.
DisGeNETi83953.
GeneCardsiFCAMR.
HGNCiHGNC:24692. FCAMR.
MIMi605484. gene.
neXtProtiNX_Q8WWV6.
PharmGKBiPA142671773.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ8T. Eukaryota.
ENOG41114ND. LUCA.
HOGENOMiHOG000112557.
HOVERGENiHBG107915.
InParanoidiQ8WWV6.
KOiK16851.
PhylomeDBiQ8WWV6.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000162897-MONOMER.

Miscellaneous databases

GenomeRNAii83953.
PROiQ8WWV6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000162897.
CleanExiHS_FCAMR.
ExpressionAtlasiQ8WWV6. baseline and differential.
GenevisibleiQ8WWV6. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFCAMR_HUMAN
AccessioniPrimary (citable) accession number: Q8WWV6
Secondary accession number(s): Q32M82, Q8WWV5, Q96SA2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 1, 2002
Last modified: November 2, 2016
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.