Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WWU5

- TCP11_HUMAN

UniProt

Q8WWU5 - TCP11_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

T-complex protein 11 homolog

Gene

TCP11

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

May play an important role in sperm function and fertility.1 Publication

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. multicellular organismal development Source: UniProtKB
  3. spermatogenesis Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
T-complex protein 11 homolog
Gene namesi
Name:TCP11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:11658. TCP11.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36409.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 503503T-complex protein 11 homologPRO_0000324298Add
BLAST

Proteomic databases

PaxDbiQ8WWU5.
PRIDEiQ8WWU5.

PTM databases

PhosphoSiteiQ8WWU5.

Expressioni

Tissue specificityi

Expressed only in fertile adult testis.1 Publication

Gene expression databases

BgeeiQ8WWU5.
CleanExiHS_TCP11.
ExpressionAtlasiQ8WWU5. baseline and differential.
GenevestigatoriQ8WWU5.

Interactioni

Protein-protein interaction databases

BioGridi112814. 3 interactions.
IntActiQ8WWU5. 2 interactions.
STRINGi9606.ENSP00000308708.

Structurei

3D structure databases

ProteinModelPortaliQ8WWU5.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei330 – 34920HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the TCP11 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG257003.
GeneTreeiENSGT00390000008958.
HOVERGENiHBG008348.
InParanoidiQ8WWU5.
OMAiNLTHHNQ.
OrthoDBiEOG77126P.
PhylomeDBiQ8WWU5.
TreeFamiTF313385.

Family and domain databases

InterProiIPR008862. Tcp11.
[Graphical view]
PANTHERiPTHR12832. PTHR12832. 1 hit.
PfamiPF05794. Tcp11. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WWU5-1) [UniParc]FASTAAdd to Basket

Also known as: TCP11b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPDVKESVPP KYPGDSEGRS CKPETSGPPQ EDKSGSEDPP PFLSVTGLTE
60 70 80 90 100
TVNEVSKLSN KIGMNCDYYM EEKVLPPSSL EGKVKETVHN AFWDHLKEQL
110 120 130 140 150
SATPPDFSCA LELLKEIKEI LLSLLLPRQN RLRIEIEEAL DMDLLKQEAE
160 170 180 190 200
HGALKVLYLS KYVLNMMALL CAPVRDEAVQ KLENITDPVW LLRGIFQVLG
210 220 230 240 250
RMKMDMVNYT IQSLQPHLQE HSIQYERAKF QELLNKQPSL LNHTTKWLTQ
260 270 280 290 300
AAGDLTMSPP TCPDTSDSSS VAGPSPNEAA NNPEPLSPTM VLCQGFLNLL
310 320 330 340 350
LWDLENEEFP ETLLMDRTRL QELKSQLHQL TVMASVLLVA SSFSGSVLFG
360 370 380 390 400
SPQFVDKLKR ITKSLLEDFH SRPEEAILTV SEQVSQEIHQ SLKNMGLVAL
410 420 430 440 450
SSDNTASLMG QLQNIAKKEN CVCSVIDQRI HLFLKCCLVL GVQRSLLDLP
460 470 480 490 500
GGLTLIEAEL AELGQKFVNL THHNQQVFGP YYTEILKTLI SPAQALETKV

ESV
Length:503
Mass (Da):56,141
Last modified:March 1, 2002 - v1
Checksum:iF567492970A3F68B
GO
Isoform 2 (identifier: Q8WWU5-2) [UniParc]FASTAAdd to Basket

Also known as: TCP11d

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: MPDVKESVPP...YMEEKVLPPS → MAPKGILGSFPTAMNL

Show »
Length:441
Mass (Da):49,329
Checksum:i8775470FD36B5FD1
GO
Isoform 3 (identifier: Q8WWU5-3) [UniParc]FASTAAdd to Basket

Also known as: TCP11c

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.

Show »
Length:440
Mass (Da):49,500
Checksum:iC7D8BBBB6F1922A7
GO
Isoform 4 (identifier: Q8WWU5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPF → MTRGGGGGV

Show »
Length:470
Mass (Da):52,445
Checksum:i2460B5E00F13D0BE
GO
Isoform 5 (identifier: Q8WWU5-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM
     42-47: FLSVTG → C

Show »
Length:511
Mass (Da):56,857
Checksum:iED9D2E59F08B05B1
GO
Isoform 6 (identifier: Q8WWU5-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVT → MTRGGGGG

Show »
Length:465
Mass (Da):51,945
Checksum:iA4D107753A3D7BFE
GO
Isoform 7 (identifier: Q8WWU5-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM

Note: Gene prediction based on EST data.

Show »
Length:516
Mass (Da):57,359
Checksum:i16C3FC861394C65F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti157 – 1571L → R in BAH13714. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti253 – 2531G → A.1 Publication
Corresponds to variant rs2234045 [ dbSNP | Ensembl ].
VAR_039692
Natural varianti429 – 4291R → Q.
Corresponds to variant rs2234051 [ dbSNP | Ensembl ].
VAR_039693

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7878MPDVK…VLPPS → MAPKGILGSFPTAMNL in isoform 2. 3 PublicationsVSP_032186Add
BLAST
Alternative sequencei1 – 6363Missing in isoform 3. 2 PublicationsVSP_032185Add
BLAST
Alternative sequencei1 – 4646MPDVK…FLSVT → MTRGGGGG in isoform 6. 1 PublicationVSP_047124Add
BLAST
Alternative sequencei1 – 4242MPDVK…DPPPF → MTRGGGGGV in isoform 4. 1 PublicationVSP_045217Add
BLAST
Alternative sequencei1 – 11M → MTRGGGGGDTISKM in isoform 5 and isoform 7. 1 PublicationVSP_047125
Alternative sequencei42 – 476FLSVTG → C in isoform 5. 1 PublicationVSP_047126

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF269223 mRNA. Translation: AAF75551.1.
AY069943 mRNA. Translation: AAL58042.1.
AF260330 mRNA. Translation: AAF91370.1.
AF536532 mRNA. Translation: AAN04044.1.
AF536533 mRNA. Translation: AAN04045.1.
AK057234 mRNA. Translation: BAG51889.1.
AK301975 mRNA. Translation: BAH13597.1.
AK315078 mRNA. Translation: BAG37546.1.
AK301778 mRNA. Translation: BAH13551.1.
AK302022 mRNA. Translation: BAH13610.1.
AK302456 mRNA. Translation: BAH13714.1.
AL138721 Genomic DNA. Translation: CAI12438.1.
CH471081 Genomic DNA. Translation: EAX03808.1.
CH471081 Genomic DNA. Translation: EAX03809.1.
BC033729 mRNA. Translation: AAH33729.1.
BC040003 mRNA. Translation: AAH40003.1.
BC048418 mRNA. Translation: AAH48418.1.
BC090050 mRNA. Translation: AAH90050.1.
CCDSiCCDS47413.1. [Q8WWU5-7]
CCDS4799.1. [Q8WWU5-2]
CCDS59015.1. [Q8WWU5-3]
CCDS59016.1. [Q8WWU5-6]
CCDS59017.1. [Q8WWU5-4]
CCDS59018.1. [Q8WWU5-5]
RefSeqiNP_001087197.1. NM_001093728.2. [Q8WWU5-7]
NP_001248746.1. NM_001261817.1. [Q8WWU5-5]
NP_001248747.1. NM_001261818.1. [Q8WWU5-4]
NP_001248748.1. NM_001261819.1. [Q8WWU5-6]
NP_001248749.1. NM_001261820.1. [Q8WWU5-3]
NP_001248750.1. NM_001261821.1. [Q8WWU5-3]
NP_061149.1. NM_018679.5. [Q8WWU5-2]
XP_005249394.1. XM_005249337.2. [Q8WWU5-2]
XP_005249395.1. XM_005249338.2. [Q8WWU5-3]
XP_006715236.1. XM_006715173.1. [Q8WWU5-3]
UniGeneiHs.435371.

Genome annotation databases

EnsembliENST00000244645; ENSP00000244645; ENSG00000124678. [Q8WWU5-2]
ENST00000311875; ENSP00000308708; ENSG00000124678. [Q8WWU5-7]
ENST00000373974; ENSP00000363085; ENSG00000124678. [Q8WWU5-4]
ENST00000373979; ENSP00000363091; ENSG00000124678. [Q8WWU5-2]
ENST00000412155; ENSP00000402816; ENSG00000124678. [Q8WWU5-6]
ENST00000418521; ENSP00000415320; ENSG00000124678. [Q8WWU5-3]
ENST00000444780; ENSP00000404479; ENSG00000124678. [Q8WWU5-5]
ENST00000512012; ENSP00000425995; ENSG00000124678. [Q8WWU5-1]
ENST00000611141; ENSP00000478603; ENSG00000124678. [Q8WWU5-3]
GeneIDi6954.
KEGGihsa:6954.
UCSCiuc003ojz.1. human. [Q8WWU5-2]
uc003okb.2. human. [Q8WWU5-1]
uc003okd.2. human.
uc011dsu.2. human.
uc011dsw.1. human.

Polymorphism databases

DMDMi74716246.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF269223 mRNA. Translation: AAF75551.1 .
AY069943 mRNA. Translation: AAL58042.1 .
AF260330 mRNA. Translation: AAF91370.1 .
AF536532 mRNA. Translation: AAN04044.1 .
AF536533 mRNA. Translation: AAN04045.1 .
AK057234 mRNA. Translation: BAG51889.1 .
AK301975 mRNA. Translation: BAH13597.1 .
AK315078 mRNA. Translation: BAG37546.1 .
AK301778 mRNA. Translation: BAH13551.1 .
AK302022 mRNA. Translation: BAH13610.1 .
AK302456 mRNA. Translation: BAH13714.1 .
AL138721 Genomic DNA. Translation: CAI12438.1 .
CH471081 Genomic DNA. Translation: EAX03808.1 .
CH471081 Genomic DNA. Translation: EAX03809.1 .
BC033729 mRNA. Translation: AAH33729.1 .
BC040003 mRNA. Translation: AAH40003.1 .
BC048418 mRNA. Translation: AAH48418.1 .
BC090050 mRNA. Translation: AAH90050.1 .
CCDSi CCDS47413.1. [Q8WWU5-7 ]
CCDS4799.1. [Q8WWU5-2 ]
CCDS59015.1. [Q8WWU5-3 ]
CCDS59016.1. [Q8WWU5-6 ]
CCDS59017.1. [Q8WWU5-4 ]
CCDS59018.1. [Q8WWU5-5 ]
RefSeqi NP_001087197.1. NM_001093728.2. [Q8WWU5-7 ]
NP_001248746.1. NM_001261817.1. [Q8WWU5-5 ]
NP_001248747.1. NM_001261818.1. [Q8WWU5-4 ]
NP_001248748.1. NM_001261819.1. [Q8WWU5-6 ]
NP_001248749.1. NM_001261820.1. [Q8WWU5-3 ]
NP_001248750.1. NM_001261821.1. [Q8WWU5-3 ]
NP_061149.1. NM_018679.5. [Q8WWU5-2 ]
XP_005249394.1. XM_005249337.2. [Q8WWU5-2 ]
XP_005249395.1. XM_005249338.2. [Q8WWU5-3 ]
XP_006715236.1. XM_006715173.1. [Q8WWU5-3 ]
UniGenei Hs.435371.

3D structure databases

ProteinModelPortali Q8WWU5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112814. 3 interactions.
IntActi Q8WWU5. 2 interactions.
STRINGi 9606.ENSP00000308708.

PTM databases

PhosphoSitei Q8WWU5.

Polymorphism databases

DMDMi 74716246.

Proteomic databases

PaxDbi Q8WWU5.
PRIDEi Q8WWU5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000244645 ; ENSP00000244645 ; ENSG00000124678 . [Q8WWU5-2 ]
ENST00000311875 ; ENSP00000308708 ; ENSG00000124678 . [Q8WWU5-7 ]
ENST00000373974 ; ENSP00000363085 ; ENSG00000124678 . [Q8WWU5-4 ]
ENST00000373979 ; ENSP00000363091 ; ENSG00000124678 . [Q8WWU5-2 ]
ENST00000412155 ; ENSP00000402816 ; ENSG00000124678 . [Q8WWU5-6 ]
ENST00000418521 ; ENSP00000415320 ; ENSG00000124678 . [Q8WWU5-3 ]
ENST00000444780 ; ENSP00000404479 ; ENSG00000124678 . [Q8WWU5-5 ]
ENST00000512012 ; ENSP00000425995 ; ENSG00000124678 . [Q8WWU5-1 ]
ENST00000611141 ; ENSP00000478603 ; ENSG00000124678 . [Q8WWU5-3 ]
GeneIDi 6954.
KEGGi hsa:6954.
UCSCi uc003ojz.1. human. [Q8WWU5-2 ]
uc003okb.2. human. [Q8WWU5-1 ]
uc003okd.2. human.
uc011dsu.2. human.
uc011dsw.1. human.

Organism-specific databases

CTDi 6954.
GeneCardsi GC06M035735.
HGNCi HGNC:11658. TCP11.
MIMi 186982. gene.
neXtProti NX_Q8WWU5.
PharmGKBi PA36409.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG257003.
GeneTreei ENSGT00390000008958.
HOVERGENi HBG008348.
InParanoidi Q8WWU5.
OMAi NLTHHNQ.
OrthoDBi EOG77126P.
PhylomeDBi Q8WWU5.
TreeFami TF313385.

Miscellaneous databases

GeneWikii TCP11.
GenomeRNAii 6954.
NextBioi 27231.
PROi Q8WWU5.
SOURCEi Search...

Gene expression databases

Bgeei Q8WWU5.
CleanExi HS_TCP11.
ExpressionAtlasi Q8WWU5. baseline and differential.
Genevestigatori Q8WWU5.

Family and domain databases

InterProi IPR008862. Tcp11.
[Graphical view ]
PANTHERi PTHR12832. PTHR12832. 1 hit.
Pfami PF05794. Tcp11. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization of the TCP11 gene which is the human homologue of the mouse gene encoding the receptor of fertilization promoting peptide."
    Ma Y., Zhang S., Xia Q., Zhang G., Huang X., Huang M., Xiao C., Pan A., Sun Y., Lebo R., Milunsky A.
    Mol. Hum. Reprod. 8:24-31(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Testis.
  2. "Cloning, expression and alternative splicing of a novel isoform of human TCP11b gene."
    Ma Y.X., Zhang S.Z., Wu Q.Q., Sun Y.
    Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35:182-188(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Cloning, expression, and alternative splicing of the novel isoform of hTCP11 gene."
    Ma Y.X., Zhang S.Z., Wu Q.Q., Sun Y., Qiu W.M., Xu W.M.
    Zhongguo Yi Xue Ke Xue Yuan Xue Bao 25:122-128(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4; 5 AND 6), VARIANT ALA-253.
    Tissue: Testis.
  5. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Testis.

Entry informationi

Entry nameiTCP11_HUMAN
AccessioniPrimary (citable) accession number: Q8WWU5
Secondary accession number(s): B2RCE9
, B3KQ27, B7Z7B5, B7Z7G1, B7Z7H4, B7Z7S8, E7EP29, J3KNG1, Q8NF85, Q9NQZ9, Q9NR39
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2002
Last modified: October 29, 2014
This is version 82 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3