Q8WWU5 (TCP11_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: T-complex protein 11 homolog | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 503 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May play an important role in sperm function and fertility. Ref.1 |
| Subcellular location | Membrane; Single-pass membrane protein Potential. |
| Tissue specificity | Expressed only in fertile adult testis. Ref.1 |
| Sequence similarities | Belongs to the TCP11 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Differentiation Spermatogenesis |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Developmental protein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell differentiation Inferred from electronic annotation. Source: UniProtKB-KW multicellular organismal developmentTraceable author statement PubMed 1893875. Source: UniProtKB spermatogenesisInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WWU5-1) Also known as: TCP11b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WWU5-2) Also known as: TCP11d; The sequence of this isoform differs from the canonical sequence as follows: 1-78: MPDVKESVPP...YMEEKVLPPS → MAPKGILGSFPTAMNL | ||||||
| Isoform 3 (identifier: Q8WWU5-3) Also known as: TCP11c; The sequence of this isoform differs from the canonical sequence as follows: 1-63: Missing. | ||||||
| Isoform 4 (identifier: Q8WWU5-4) The sequence of this isoform differs from the canonical sequence as follows: 1-42: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPF → MTRGGGGGV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 503 | 503 | T-complex protein 11 homolog | PRO_0000324298 | |||||
Regions | |||||||||
| Transmembrane | 330 – 349 | 20 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 78 | 78 | MPDVK…VLPPS → MAPKGILGSFPTAMNL in isoform 2. | VSP_032186 | |||||
| Alternative sequence | 1 – 63 | 63 | Missing in isoform 3. | VSP_032185 | |||||
| Alternative sequence | 1 – 42 | 42 | MPDVK…DPPPF → MTRGGGGGV in isoform 4. | VSP_045217 | |||||
| Natural variant | 253 | 1 | G → A. Corresponds to variant rs2234045 [ dbSNP | Ensembl ]. | VAR_039692 | |||||
| Natural variant | 429 | 1 | R → Q. Corresponds to variant rs2234051 [ dbSNP | Ensembl ]. | VAR_039693 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular characterization of the TCP11 gene which is the human homologue of the mouse gene encoding the receptor of fertilization promoting peptide." Ma Y., Zhang S., Xia Q., Zhang G., Huang X., Huang M., Xiao C., Pan A., Sun Y., Lebo R., Milunsky A. Mol. Hum. Reprod. 8:24-31(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | "Cloning, expression and alternative splicing of a novel isoform of human TCP11b gene." Ma Y.X., Zhang S.Z., Wu Q.Q., Sun Y. Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35:182-188(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Cloning, expression, and alternative splicing of the novel isoform of hTCP11 gene." Ma Y.X., Zhang S.Z., Wu Q.Q., Sun Y., Qiu W.M., Xu W.M. Zhongguo Yi Xue Ke Xue Yuan Xue Bao 25:122-128(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4). Tissue: Testis. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain and Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF269223 mRNA. Translation: AAF75551.1. AY069943 mRNA. Translation: AAL58042.1. AF260330 mRNA. Translation: AAF91370.1. AF536532 mRNA. Translation: AAN04044.1. AF536533 mRNA. Translation: AAN04045.1. AK057234 mRNA. Translation: BAG51889.1. AK301975 mRNA. Translation: BAH13597.1. AK315078 mRNA. Translation: BAG37546.1. AL138721 Genomic DNA. Translation: CAI12438.1. CH471081 Genomic DNA. Translation: EAX03809.1. BC033729 mRNA. Translation: AAH33729.1. BC040003 mRNA. Translation: AAH40003.1. BC048418 mRNA. Translation: AAH48418.1. BC090050 mRNA. Translation: AAH90050.1. |
| IPI | IPI00103433. IPI00396136. IPI00888582. |
| RefSeq | NP_001087197.1. NM_001093728.2. NP_001248746.1. NM_001261817.1. NP_001248747.1. NM_001261818.1. NP_001248748.1. NM_001261819.1. NP_001248749.1. NM_001261820.1. NP_001248750.1. NM_001261821.1. NP_061149.1. NM_018679.5. |
| UniGene | Hs.435371. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8WWU5. 2 interactions. |
| STRING | 9606.ENSP00000308708. |
PTM databases | |
| PhosphoSite | Q8WWU5. |
Polymorphism databases | |
| DMDM | 74716246. |
Proteomic databases | |
| PaxDb | Q8WWU5. |
| PRIDE | Q8WWU5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000244645; ENSP00000244645; ENSG00000124678. ENST00000373974; ENSP00000363085; ENSG00000124678. ENST00000373979; ENSP00000363091; ENSG00000124678. ENST00000418521; ENSP00000415320; ENSG00000124678. ENST00000512012; ENSP00000425995; ENSG00000124678. |
| GeneID | 6954. |
| KEGG | hsa:6954. |
| UCSC | uc003ojz.1. human. uc003okb.2. human. |
Organism-specific databases | |
| CTD | 6954. |
| GeneCards | GC06M035132. |
| HGNC | HGNC:11658. TCP11. |
| MIM | 186982. gene. |
| neXtProt | NX_Q8WWU5. |
| PharmGKB | PA36409. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG257003. |
| HOVERGEN | HBG008348. |
| InParanoid | Q8WWU5. |
| PhylomeDB | Q8WWU5. |
Gene expression databases | |
| ArrayExpress | Q8WWU5. |
| Bgee | Q8WWU5. |
| CleanEx | HS_TCP11. |
| Genevestigator | Q8WWU5. |
Family and domain databases | |
| InterPro | IPR008862. Tcp11. [Graphical view] |
| PANTHER | PTHR12832. PTHR12832. 1 hit. |
| Pfam | PF05794. Tcp11. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 6954. |
| NextBio | 27231. |
| SOURCE | Search... |
Entry information
| Entry name | TCP11_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WWU5 Secondary accession number(s): B2RCE9 Q9NR39 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
