Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WWU5

- TCP11_HUMAN

UniProt

Q8WWU5 - TCP11_HUMAN

Protein

T-complex protein 11 homolog

Gene

TCP11

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 81 (01 Oct 2014)
      Sequence version 1 (01 Mar 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play an important role in sperm function and fertility.1 Publication

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. multicellular organismal development Source: UniProtKB
    3. spermatogenesis Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Spermatogenesis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    T-complex protein 11 homolog
    Gene namesi
    Name:TCP11
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:11658. TCP11.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36409.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 503503T-complex protein 11 homologPRO_0000324298Add
    BLAST

    Proteomic databases

    PaxDbiQ8WWU5.
    PRIDEiQ8WWU5.

    PTM databases

    PhosphoSiteiQ8WWU5.

    Expressioni

    Tissue specificityi

    Expressed only in fertile adult testis.1 Publication

    Gene expression databases

    ArrayExpressiQ8WWU5.
    BgeeiQ8WWU5.
    CleanExiHS_TCP11.
    GenevestigatoriQ8WWU5.

    Interactioni

    Protein-protein interaction databases

    BioGridi112814. 3 interactions.
    IntActiQ8WWU5. 2 interactions.
    STRINGi9606.ENSP00000308708.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8WWU5.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei330 – 34920HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the TCP11 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG257003.
    HOVERGENiHBG008348.
    InParanoidiQ8WWU5.
    OMAiNLTHHNQ.
    OrthoDBiEOG77126P.
    PhylomeDBiQ8WWU5.
    TreeFamiTF313385.

    Family and domain databases

    InterProiIPR008862. Tcp11.
    [Graphical view]
    PANTHERiPTHR12832. PTHR12832. 1 hit.
    PfamiPF05794. Tcp11. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8WWU5-1) [UniParc]FASTAAdd to Basket

    Also known as: TCP11b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPDVKESVPP KYPGDSEGRS CKPETSGPPQ EDKSGSEDPP PFLSVTGLTE    50
    TVNEVSKLSN KIGMNCDYYM EEKVLPPSSL EGKVKETVHN AFWDHLKEQL 100
    SATPPDFSCA LELLKEIKEI LLSLLLPRQN RLRIEIEEAL DMDLLKQEAE 150
    HGALKVLYLS KYVLNMMALL CAPVRDEAVQ KLENITDPVW LLRGIFQVLG 200
    RMKMDMVNYT IQSLQPHLQE HSIQYERAKF QELLNKQPSL LNHTTKWLTQ 250
    AAGDLTMSPP TCPDTSDSSS VAGPSPNEAA NNPEPLSPTM VLCQGFLNLL 300
    LWDLENEEFP ETLLMDRTRL QELKSQLHQL TVMASVLLVA SSFSGSVLFG 350
    SPQFVDKLKR ITKSLLEDFH SRPEEAILTV SEQVSQEIHQ SLKNMGLVAL 400
    SSDNTASLMG QLQNIAKKEN CVCSVIDQRI HLFLKCCLVL GVQRSLLDLP 450
    GGLTLIEAEL AELGQKFVNL THHNQQVFGP YYTEILKTLI SPAQALETKV 500
    ESV 503
    Length:503
    Mass (Da):56,141
    Last modified:March 1, 2002 - v1
    Checksum:iF567492970A3F68B
    GO
    Isoform 2 (identifier: Q8WWU5-2) [UniParc]FASTAAdd to Basket

    Also known as: TCP11d

    The sequence of this isoform differs from the canonical sequence as follows:
         1-78: MPDVKESVPP...YMEEKVLPPS → MAPKGILGSFPTAMNL

    Show »
    Length:441
    Mass (Da):49,329
    Checksum:i8775470FD36B5FD1
    GO
    Isoform 3 (identifier: Q8WWU5-3) [UniParc]FASTAAdd to Basket

    Also known as: TCP11c

    The sequence of this isoform differs from the canonical sequence as follows:
         1-63: Missing.

    Show »
    Length:440
    Mass (Da):49,500
    Checksum:iC7D8BBBB6F1922A7
    GO
    Isoform 4 (identifier: Q8WWU5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-42: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPF → MTRGGGGGV

    Show »
    Length:470
    Mass (Da):52,445
    Checksum:i2460B5E00F13D0BE
    GO
    Isoform 5 (identifier: Q8WWU5-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MTRGGGGGDTISKM
         42-47: FLSVTG → C

    Show »
    Length:511
    Mass (Da):56,857
    Checksum:iED9D2E59F08B05B1
    GO
    Isoform 6 (identifier: Q8WWU5-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVT → MTRGGGGG

    Show »
    Length:465
    Mass (Da):51,945
    Checksum:iA4D107753A3D7BFE
    GO
    Isoform 7 (identifier: Q8WWU5-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MTRGGGGGDTISKM

    Note: Gene prediction based on EST data.

    Show »
    Length:516
    Mass (Da):57,359
    Checksum:i16C3FC861394C65F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti157 – 1571L → R in BAH13714. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti253 – 2531G → A.1 Publication
    Corresponds to variant rs2234045 [ dbSNP | Ensembl ].
    VAR_039692
    Natural varianti429 – 4291R → Q.
    Corresponds to variant rs2234051 [ dbSNP | Ensembl ].
    VAR_039693

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7878MPDVK…VLPPS → MAPKGILGSFPTAMNL in isoform 2. 3 PublicationsVSP_032186Add
    BLAST
    Alternative sequencei1 – 6363Missing in isoform 3. 2 PublicationsVSP_032185Add
    BLAST
    Alternative sequencei1 – 4646MPDVK…FLSVT → MTRGGGGG in isoform 6. 1 PublicationVSP_047124Add
    BLAST
    Alternative sequencei1 – 4242MPDVK…DPPPF → MTRGGGGGV in isoform 4. 1 PublicationVSP_045217Add
    BLAST
    Alternative sequencei1 – 11M → MTRGGGGGDTISKM in isoform 5 and isoform 7. 1 PublicationVSP_047125
    Alternative sequencei42 – 476FLSVTG → C in isoform 5. 1 PublicationVSP_047126

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF269223 mRNA. Translation: AAF75551.1.
    AY069943 mRNA. Translation: AAL58042.1.
    AF260330 mRNA. Translation: AAF91370.1.
    AF536532 mRNA. Translation: AAN04044.1.
    AF536533 mRNA. Translation: AAN04045.1.
    AK057234 mRNA. Translation: BAG51889.1.
    AK301975 mRNA. Translation: BAH13597.1.
    AK315078 mRNA. Translation: BAG37546.1.
    AK301778 mRNA. Translation: BAH13551.1.
    AK302022 mRNA. Translation: BAH13610.1.
    AK302456 mRNA. Translation: BAH13714.1.
    AL138721 Genomic DNA. Translation: CAI12438.1.
    CH471081 Genomic DNA. Translation: EAX03808.1.
    CH471081 Genomic DNA. Translation: EAX03809.1.
    BC033729 mRNA. Translation: AAH33729.1.
    BC040003 mRNA. Translation: AAH40003.1.
    BC048418 mRNA. Translation: AAH48418.1.
    BC090050 mRNA. Translation: AAH90050.1.
    CCDSiCCDS47413.1. [Q8WWU5-7]
    CCDS4799.1. [Q8WWU5-2]
    CCDS59015.1. [Q8WWU5-3]
    CCDS59016.1. [Q8WWU5-6]
    CCDS59017.1. [Q8WWU5-4]
    CCDS59018.1. [Q8WWU5-5]
    RefSeqiNP_001087197.1. NM_001093728.2. [Q8WWU5-7]
    NP_001248746.1. NM_001261817.1. [Q8WWU5-5]
    NP_001248747.1. NM_001261818.1. [Q8WWU5-4]
    NP_001248748.1. NM_001261819.1. [Q8WWU5-6]
    NP_001248749.1. NM_001261820.1. [Q8WWU5-3]
    NP_001248750.1. NM_001261821.1. [Q8WWU5-3]
    NP_061149.1. NM_018679.5. [Q8WWU5-2]
    XP_005249394.1. XM_005249337.2. [Q8WWU5-2]
    XP_005249395.1. XM_005249338.2. [Q8WWU5-3]
    XP_006715236.1. XM_006715173.1. [Q8WWU5-3]
    UniGeneiHs.435371.

    Genome annotation databases

    EnsembliENST00000244645; ENSP00000244645; ENSG00000124678. [Q8WWU5-2]
    ENST00000311875; ENSP00000308708; ENSG00000124678. [Q8WWU5-7]
    ENST00000373974; ENSP00000363085; ENSG00000124678. [Q8WWU5-4]
    ENST00000373979; ENSP00000363091; ENSG00000124678. [Q8WWU5-2]
    ENST00000412155; ENSP00000402816; ENSG00000124678. [Q8WWU5-6]
    ENST00000418521; ENSP00000415320; ENSG00000124678. [Q8WWU5-3]
    ENST00000444780; ENSP00000404479; ENSG00000124678. [Q8WWU5-5]
    ENST00000512012; ENSP00000425995; ENSG00000124678. [Q8WWU5-1]
    GeneIDi6954.
    KEGGihsa:6954.
    UCSCiuc003ojz.1. human. [Q8WWU5-2]
    uc003okb.2. human. [Q8WWU5-1]
    uc003okd.2. human.
    uc011dsw.1. human.

    Polymorphism databases

    DMDMi74716246.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF269223 mRNA. Translation: AAF75551.1 .
    AY069943 mRNA. Translation: AAL58042.1 .
    AF260330 mRNA. Translation: AAF91370.1 .
    AF536532 mRNA. Translation: AAN04044.1 .
    AF536533 mRNA. Translation: AAN04045.1 .
    AK057234 mRNA. Translation: BAG51889.1 .
    AK301975 mRNA. Translation: BAH13597.1 .
    AK315078 mRNA. Translation: BAG37546.1 .
    AK301778 mRNA. Translation: BAH13551.1 .
    AK302022 mRNA. Translation: BAH13610.1 .
    AK302456 mRNA. Translation: BAH13714.1 .
    AL138721 Genomic DNA. Translation: CAI12438.1 .
    CH471081 Genomic DNA. Translation: EAX03808.1 .
    CH471081 Genomic DNA. Translation: EAX03809.1 .
    BC033729 mRNA. Translation: AAH33729.1 .
    BC040003 mRNA. Translation: AAH40003.1 .
    BC048418 mRNA. Translation: AAH48418.1 .
    BC090050 mRNA. Translation: AAH90050.1 .
    CCDSi CCDS47413.1. [Q8WWU5-7 ]
    CCDS4799.1. [Q8WWU5-2 ]
    CCDS59015.1. [Q8WWU5-3 ]
    CCDS59016.1. [Q8WWU5-6 ]
    CCDS59017.1. [Q8WWU5-4 ]
    CCDS59018.1. [Q8WWU5-5 ]
    RefSeqi NP_001087197.1. NM_001093728.2. [Q8WWU5-7 ]
    NP_001248746.1. NM_001261817.1. [Q8WWU5-5 ]
    NP_001248747.1. NM_001261818.1. [Q8WWU5-4 ]
    NP_001248748.1. NM_001261819.1. [Q8WWU5-6 ]
    NP_001248749.1. NM_001261820.1. [Q8WWU5-3 ]
    NP_001248750.1. NM_001261821.1. [Q8WWU5-3 ]
    NP_061149.1. NM_018679.5. [Q8WWU5-2 ]
    XP_005249394.1. XM_005249337.2. [Q8WWU5-2 ]
    XP_005249395.1. XM_005249338.2. [Q8WWU5-3 ]
    XP_006715236.1. XM_006715173.1. [Q8WWU5-3 ]
    UniGenei Hs.435371.

    3D structure databases

    ProteinModelPortali Q8WWU5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112814. 3 interactions.
    IntActi Q8WWU5. 2 interactions.
    STRINGi 9606.ENSP00000308708.

    PTM databases

    PhosphoSitei Q8WWU5.

    Polymorphism databases

    DMDMi 74716246.

    Proteomic databases

    PaxDbi Q8WWU5.
    PRIDEi Q8WWU5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000244645 ; ENSP00000244645 ; ENSG00000124678 . [Q8WWU5-2 ]
    ENST00000311875 ; ENSP00000308708 ; ENSG00000124678 . [Q8WWU5-7 ]
    ENST00000373974 ; ENSP00000363085 ; ENSG00000124678 . [Q8WWU5-4 ]
    ENST00000373979 ; ENSP00000363091 ; ENSG00000124678 . [Q8WWU5-2 ]
    ENST00000412155 ; ENSP00000402816 ; ENSG00000124678 . [Q8WWU5-6 ]
    ENST00000418521 ; ENSP00000415320 ; ENSG00000124678 . [Q8WWU5-3 ]
    ENST00000444780 ; ENSP00000404479 ; ENSG00000124678 . [Q8WWU5-5 ]
    ENST00000512012 ; ENSP00000425995 ; ENSG00000124678 . [Q8WWU5-1 ]
    GeneIDi 6954.
    KEGGi hsa:6954.
    UCSCi uc003ojz.1. human. [Q8WWU5-2 ]
    uc003okb.2. human. [Q8WWU5-1 ]
    uc003okd.2. human.
    uc011dsw.1. human.

    Organism-specific databases

    CTDi 6954.
    GeneCardsi GC06M035240.
    HGNCi HGNC:11658. TCP11.
    MIMi 186982. gene.
    neXtProti NX_Q8WWU5.
    PharmGKBi PA36409.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG257003.
    HOVERGENi HBG008348.
    InParanoidi Q8WWU5.
    OMAi NLTHHNQ.
    OrthoDBi EOG77126P.
    PhylomeDBi Q8WWU5.
    TreeFami TF313385.

    Miscellaneous databases

    GeneWikii TCP11.
    GenomeRNAii 6954.
    NextBioi 27231.
    PROi Q8WWU5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8WWU5.
    Bgeei Q8WWU5.
    CleanExi HS_TCP11.
    Genevestigatori Q8WWU5.

    Family and domain databases

    InterProi IPR008862. Tcp11.
    [Graphical view ]
    PANTHERi PTHR12832. PTHR12832. 1 hit.
    Pfami PF05794. Tcp11. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular characterization of the TCP11 gene which is the human homologue of the mouse gene encoding the receptor of fertilization promoting peptide."
      Ma Y., Zhang S., Xia Q., Zhang G., Huang X., Huang M., Xiao C., Pan A., Sun Y., Lebo R., Milunsky A.
      Mol. Hum. Reprod. 8:24-31(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Testis.
    2. "Cloning, expression and alternative splicing of a novel isoform of human TCP11b gene."
      Ma Y.X., Zhang S.Z., Wu Q.Q., Sun Y.
      Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35:182-188(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Cloning, expression, and alternative splicing of the novel isoform of hTCP11 gene."
      Ma Y.X., Zhang S.Z., Wu Q.Q., Sun Y., Qiu W.M., Xu W.M.
      Zhongguo Yi Xue Ke Xue Yuan Xue Bao 25:122-128(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4; 5 AND 6), VARIANT ALA-253.
      Tissue: Testis.
    5. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain and Testis.

    Entry informationi

    Entry nameiTCP11_HUMAN
    AccessioniPrimary (citable) accession number: Q8WWU5
    Secondary accession number(s): B2RCE9
    , B3KQ27, B7Z7B5, B7Z7G1, B7Z7H4, B7Z7S8, E7EP29, J3KNG1, Q8NF85, Q9NQZ9, Q9NR39
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 18, 2008
    Last sequence update: March 1, 2002
    Last modified: October 1, 2014
    This is version 81 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3