Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-complex protein 11 homolog

Gene

TCP11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May play an important role in sperm function and fertility.1 Publication

GO - Biological processi

  • cell differentiation Source: UniProtKB-KW
  • multicellular organism development Source: UniProtKB
  • spermatogenesis Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
T-complex protein 11 homolog
Gene namesi
Name:TCP11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:11658. TCP11.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei330 – 349HelicalSequence analysisAdd BLAST20

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000124678.
PharmGKBiPA36409.

Polymorphism and mutation databases

BioMutaiTCP11.
DMDMi74716246.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003242981 – 503T-complex protein 11 homologAdd BLAST503

Proteomic databases

PaxDbiQ8WWU5.
PeptideAtlasiQ8WWU5.
PRIDEiQ8WWU5.
TopDownProteomicsiQ8WWU5-2. [Q8WWU5-2]

PTM databases

iPTMnetiQ8WWU5.
PhosphoSitePlusiQ8WWU5.

Expressioni

Tissue specificityi

Expressed only in fertile adult testis.1 Publication

Gene expression databases

BgeeiENSG00000124678.
CleanExiHS_TCP11.
ExpressionAtlasiQ8WWU5. baseline and differential.
GenevisibleiQ8WWU5. HS.

Organism-specific databases

HPAiHPA048311.

Interactioni

Protein-protein interaction databases

BioGridi112814. 3 interactors.
IntActiQ8WWU5. 2 interactors.
STRINGi9606.ENSP00000308708.

Structurei

3D structure databases

ProteinModelPortaliQ8WWU5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TCP11 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1981. Eukaryota.
ENOG410ZDEH. LUCA.
GeneTreeiENSGT00390000008958.
HOGENOMiHOG000231350.
HOVERGENiHBG008348.
InParanoidiQ8WWU5.
OMAiNLTHHNQ.
OrthoDBiEOG091G07AC.
PhylomeDBiQ8WWU5.
TreeFamiTF313385.

Family and domain databases

InterProiIPR008862. Tcp11.
[Graphical view]
PANTHERiPTHR12832. PTHR12832. 1 hit.
PfamiPF05794. Tcp11. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WWU5-1) [UniParc]FASTAAdd to basket
Also known as: TCP11b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPDVKESVPP KYPGDSEGRS CKPETSGPPQ EDKSGSEDPP PFLSVTGLTE
60 70 80 90 100
TVNEVSKLSN KIGMNCDYYM EEKVLPPSSL EGKVKETVHN AFWDHLKEQL
110 120 130 140 150
SATPPDFSCA LELLKEIKEI LLSLLLPRQN RLRIEIEEAL DMDLLKQEAE
160 170 180 190 200
HGALKVLYLS KYVLNMMALL CAPVRDEAVQ KLENITDPVW LLRGIFQVLG
210 220 230 240 250
RMKMDMVNYT IQSLQPHLQE HSIQYERAKF QELLNKQPSL LNHTTKWLTQ
260 270 280 290 300
AAGDLTMSPP TCPDTSDSSS VAGPSPNEAA NNPEPLSPTM VLCQGFLNLL
310 320 330 340 350
LWDLENEEFP ETLLMDRTRL QELKSQLHQL TVMASVLLVA SSFSGSVLFG
360 370 380 390 400
SPQFVDKLKR ITKSLLEDFH SRPEEAILTV SEQVSQEIHQ SLKNMGLVAL
410 420 430 440 450
SSDNTASLMG QLQNIAKKEN CVCSVIDQRI HLFLKCCLVL GVQRSLLDLP
460 470 480 490 500
GGLTLIEAEL AELGQKFVNL THHNQQVFGP YYTEILKTLI SPAQALETKV

ESV
Length:503
Mass (Da):56,141
Last modified:March 1, 2002 - v1
Checksum:iF567492970A3F68B
GO
Isoform 2 (identifier: Q8WWU5-2) [UniParc]FASTAAdd to basket
Also known as: TCP11d

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: MPDVKESVPP...YMEEKVLPPS → MAPKGILGSFPTAMNL

Show »
Length:441
Mass (Da):49,329
Checksum:i8775470FD36B5FD1
GO
Isoform 3 (identifier: Q8WWU5-3) [UniParc]FASTAAdd to basket
Also known as: TCP11c

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.

Show »
Length:440
Mass (Da):49,500
Checksum:iC7D8BBBB6F1922A7
GO
Isoform 4 (identifier: Q8WWU5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPF → MTRGGGGGV

Show »
Length:470
Mass (Da):52,445
Checksum:i2460B5E00F13D0BE
GO
Isoform 5 (identifier: Q8WWU5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM
     42-47: FLSVTG → C

Show »
Length:511
Mass (Da):56,857
Checksum:iED9D2E59F08B05B1
GO
Isoform 6 (identifier: Q8WWU5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVT → MTRGGGGG

Show »
Length:465
Mass (Da):51,945
Checksum:iA4D107753A3D7BFE
GO
Isoform 7 (identifier: Q8WWU5-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM

Note: Gene prediction based on EST data.
Show »
Length:516
Mass (Da):57,359
Checksum:i16C3FC861394C65F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti157L → R in BAH13714 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039692253G → A.1 PublicationCorresponds to variant rs2234045dbSNPEnsembl.1
Natural variantiVAR_039693429R → Q.Corresponds to variant rs2234051dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0321861 – 78MPDVK…VLPPS → MAPKGILGSFPTAMNL in isoform 2. 3 PublicationsAdd BLAST78
Alternative sequenceiVSP_0321851 – 63Missing in isoform 3. 2 PublicationsAdd BLAST63
Alternative sequenceiVSP_0471241 – 46MPDVK…FLSVT → MTRGGGGG in isoform 6. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0452171 – 42MPDVK…DPPPF → MTRGGGGGV in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_0471251M → MTRGGGGGDTISKM in isoform 5 and isoform 7. 1 Publication1
Alternative sequenceiVSP_04712642 – 47FLSVTG → C in isoform 5. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF269223 mRNA. Translation: AAF75551.1.
AY069943 mRNA. Translation: AAL58042.1.
AF260330 mRNA. Translation: AAF91370.1.
AF536532 mRNA. Translation: AAN04044.1.
AF536533 mRNA. Translation: AAN04045.1.
AK057234 mRNA. Translation: BAG51889.1.
AK301975 mRNA. Translation: BAH13597.1.
AK315078 mRNA. Translation: BAG37546.1.
AK301778 mRNA. Translation: BAH13551.1.
AK302022 mRNA. Translation: BAH13610.1.
AK302456 mRNA. Translation: BAH13714.1.
AL138721 Genomic DNA. Translation: CAI12438.1.
CH471081 Genomic DNA. Translation: EAX03808.1.
CH471081 Genomic DNA. Translation: EAX03809.1.
BC033729 mRNA. Translation: AAH33729.1.
BC040003 mRNA. Translation: AAH40003.1.
BC048418 mRNA. Translation: AAH48418.1.
BC090050 mRNA. Translation: AAH90050.1.
CCDSiCCDS47413.1. [Q8WWU5-7]
CCDS4799.1. [Q8WWU5-2]
CCDS59015.1. [Q8WWU5-3]
CCDS59016.1. [Q8WWU5-6]
CCDS59017.1. [Q8WWU5-4]
CCDS59018.1. [Q8WWU5-5]
RefSeqiNP_001087197.1. NM_001093728.2. [Q8WWU5-7]
NP_001248746.1. NM_001261817.1. [Q8WWU5-5]
NP_001248747.1. NM_001261818.1. [Q8WWU5-4]
NP_001248748.1. NM_001261819.1. [Q8WWU5-6]
NP_001248749.1. NM_001261820.1. [Q8WWU5-3]
NP_001248750.1. NM_001261821.1. [Q8WWU5-3]
NP_061149.1. NM_018679.5. [Q8WWU5-2]
UniGeneiHs.435371.

Genome annotation databases

EnsembliENST00000244645; ENSP00000244645; ENSG00000124678. [Q8WWU5-2]
ENST00000311875; ENSP00000308708; ENSG00000124678. [Q8WWU5-7]
ENST00000373974; ENSP00000363085; ENSG00000124678. [Q8WWU5-4]
ENST00000373979; ENSP00000363091; ENSG00000124678. [Q8WWU5-2]
ENST00000412155; ENSP00000402816; ENSG00000124678. [Q8WWU5-6]
ENST00000418521; ENSP00000415320; ENSG00000124678. [Q8WWU5-3]
ENST00000444780; ENSP00000404479; ENSG00000124678. [Q8WWU5-5]
ENST00000512012; ENSP00000425995; ENSG00000124678. [Q8WWU5-1]
ENST00000611141; ENSP00000478603; ENSG00000124678. [Q8WWU5-3]
GeneIDi6954.
KEGGihsa:6954.
UCSCiuc003ojz.3. human. [Q8WWU5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF269223 mRNA. Translation: AAF75551.1.
AY069943 mRNA. Translation: AAL58042.1.
AF260330 mRNA. Translation: AAF91370.1.
AF536532 mRNA. Translation: AAN04044.1.
AF536533 mRNA. Translation: AAN04045.1.
AK057234 mRNA. Translation: BAG51889.1.
AK301975 mRNA. Translation: BAH13597.1.
AK315078 mRNA. Translation: BAG37546.1.
AK301778 mRNA. Translation: BAH13551.1.
AK302022 mRNA. Translation: BAH13610.1.
AK302456 mRNA. Translation: BAH13714.1.
AL138721 Genomic DNA. Translation: CAI12438.1.
CH471081 Genomic DNA. Translation: EAX03808.1.
CH471081 Genomic DNA. Translation: EAX03809.1.
BC033729 mRNA. Translation: AAH33729.1.
BC040003 mRNA. Translation: AAH40003.1.
BC048418 mRNA. Translation: AAH48418.1.
BC090050 mRNA. Translation: AAH90050.1.
CCDSiCCDS47413.1. [Q8WWU5-7]
CCDS4799.1. [Q8WWU5-2]
CCDS59015.1. [Q8WWU5-3]
CCDS59016.1. [Q8WWU5-6]
CCDS59017.1. [Q8WWU5-4]
CCDS59018.1. [Q8WWU5-5]
RefSeqiNP_001087197.1. NM_001093728.2. [Q8WWU5-7]
NP_001248746.1. NM_001261817.1. [Q8WWU5-5]
NP_001248747.1. NM_001261818.1. [Q8WWU5-4]
NP_001248748.1. NM_001261819.1. [Q8WWU5-6]
NP_001248749.1. NM_001261820.1. [Q8WWU5-3]
NP_001248750.1. NM_001261821.1. [Q8WWU5-3]
NP_061149.1. NM_018679.5. [Q8WWU5-2]
UniGeneiHs.435371.

3D structure databases

ProteinModelPortaliQ8WWU5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112814. 3 interactors.
IntActiQ8WWU5. 2 interactors.
STRINGi9606.ENSP00000308708.

PTM databases

iPTMnetiQ8WWU5.
PhosphoSitePlusiQ8WWU5.

Polymorphism and mutation databases

BioMutaiTCP11.
DMDMi74716246.

Proteomic databases

PaxDbiQ8WWU5.
PeptideAtlasiQ8WWU5.
PRIDEiQ8WWU5.
TopDownProteomicsiQ8WWU5-2. [Q8WWU5-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000244645; ENSP00000244645; ENSG00000124678. [Q8WWU5-2]
ENST00000311875; ENSP00000308708; ENSG00000124678. [Q8WWU5-7]
ENST00000373974; ENSP00000363085; ENSG00000124678. [Q8WWU5-4]
ENST00000373979; ENSP00000363091; ENSG00000124678. [Q8WWU5-2]
ENST00000412155; ENSP00000402816; ENSG00000124678. [Q8WWU5-6]
ENST00000418521; ENSP00000415320; ENSG00000124678. [Q8WWU5-3]
ENST00000444780; ENSP00000404479; ENSG00000124678. [Q8WWU5-5]
ENST00000512012; ENSP00000425995; ENSG00000124678. [Q8WWU5-1]
ENST00000611141; ENSP00000478603; ENSG00000124678. [Q8WWU5-3]
GeneIDi6954.
KEGGihsa:6954.
UCSCiuc003ojz.3. human. [Q8WWU5-1]

Organism-specific databases

CTDi6954.
GeneCardsiTCP11.
HGNCiHGNC:11658. TCP11.
HPAiHPA048311.
MIMi186982. gene.
neXtProtiNX_Q8WWU5.
OpenTargetsiENSG00000124678.
PharmGKBiPA36409.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1981. Eukaryota.
ENOG410ZDEH. LUCA.
GeneTreeiENSGT00390000008958.
HOGENOMiHOG000231350.
HOVERGENiHBG008348.
InParanoidiQ8WWU5.
OMAiNLTHHNQ.
OrthoDBiEOG091G07AC.
PhylomeDBiQ8WWU5.
TreeFamiTF313385.

Miscellaneous databases

GeneWikiiTCP11.
GenomeRNAii6954.
PROiQ8WWU5.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124678.
CleanExiHS_TCP11.
ExpressionAtlasiQ8WWU5. baseline and differential.
GenevisibleiQ8WWU5. HS.

Family and domain databases

InterProiIPR008862. Tcp11.
[Graphical view]
PANTHERiPTHR12832. PTHR12832. 1 hit.
PfamiPF05794. Tcp11. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTCP11_HUMAN
AccessioniPrimary (citable) accession number: Q8WWU5
Secondary accession number(s): B2RCE9
, B3KQ27, B7Z7B5, B7Z7G1, B7Z7H4, B7Z7S8, E7EP29, J3KNG1, Q8NF85, Q9NQZ9, Q9NR39
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2002
Last modified: November 2, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.