Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8WWU5 (TCP11_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 79. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
T-complex protein 11 homolog
Gene names
Name:TCP11
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length503 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May play an important role in sperm function and fertility. Ref.1

Subcellular location

Membrane; Single-pass membrane protein Potential.

Tissue specificity

Expressed only in fertile adult testis. Ref.1

Sequence similarities

Belongs to the TCP11 family.

Ontologies

Keywords
   Biological processDifferentiation
Spermatogenesis
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   Molecular functionDevelopmental protein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell differentiation

Inferred from electronic annotation. Source: UniProtKB-KW

multicellular organismal development

Traceable author statement PubMed 1893875. Source: UniProtKB

spermatogenesis

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8WWU5-1)

Also known as: TCP11b;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8WWU5-2)

Also known as: TCP11d;

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: MPDVKESVPP...YMEEKVLPPS → MAPKGILGSFPTAMNL
Isoform 3 (identifier: Q8WWU5-3)

Also known as: TCP11c;

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.
Isoform 4 (identifier: Q8WWU5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPF → MTRGGGGGV
Isoform 5 (identifier: Q8WWU5-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM
     42-47: FLSVTG → C
Isoform 6 (identifier: Q8WWU5-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVT → MTRGGGGG
Isoform 7 (identifier: Q8WWU5-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTRGGGGGDTISKM
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 503503T-complex protein 11 homolog
PRO_0000324298

Regions

Transmembrane330 – 34920Helical; Potential

Natural variations

Alternative sequence1 – 7878MPDVK…VLPPS → MAPKGILGSFPTAMNL in isoform 2.
VSP_032186
Alternative sequence1 – 6363Missing in isoform 3.
VSP_032185
Alternative sequence1 – 4646MPDVK…FLSVT → MTRGGGGG in isoform 6.
VSP_047124
Alternative sequence1 – 4242MPDVK…DPPPF → MTRGGGGGV in isoform 4.
VSP_045217
Alternative sequence11M → MTRGGGGGDTISKM in isoform 5 and isoform 7.
VSP_047125
Alternative sequence42 – 476FLSVTG → C in isoform 5.
VSP_047126
Natural variant2531G → A. Ref.4
Corresponds to variant rs2234045 [ dbSNP | Ensembl ].
VAR_039692
Natural variant4291R → Q.
Corresponds to variant rs2234051 [ dbSNP | Ensembl ].
VAR_039693

Experimental info

Sequence conflict1571L → R in BAH13714. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (TCP11b) [UniParc].

Last modified March 1, 2002. Version 1.
Checksum: F567492970A3F68B

FASTA50356,141
        10         20         30         40         50         60 
MPDVKESVPP KYPGDSEGRS CKPETSGPPQ EDKSGSEDPP PFLSVTGLTE TVNEVSKLSN 

        70         80         90        100        110        120 
KIGMNCDYYM EEKVLPPSSL EGKVKETVHN AFWDHLKEQL SATPPDFSCA LELLKEIKEI 

       130        140        150        160        170        180 
LLSLLLPRQN RLRIEIEEAL DMDLLKQEAE HGALKVLYLS KYVLNMMALL CAPVRDEAVQ 

       190        200        210        220        230        240 
KLENITDPVW LLRGIFQVLG RMKMDMVNYT IQSLQPHLQE HSIQYERAKF QELLNKQPSL 

       250        260        270        280        290        300 
LNHTTKWLTQ AAGDLTMSPP TCPDTSDSSS VAGPSPNEAA NNPEPLSPTM VLCQGFLNLL 

       310        320        330        340        350        360 
LWDLENEEFP ETLLMDRTRL QELKSQLHQL TVMASVLLVA SSFSGSVLFG SPQFVDKLKR 

       370        380        390        400        410        420 
ITKSLLEDFH SRPEEAILTV SEQVSQEIHQ SLKNMGLVAL SSDNTASLMG QLQNIAKKEN 

       430        440        450        460        470        480 
CVCSVIDQRI HLFLKCCLVL GVQRSLLDLP GGLTLIEAEL AELGQKFVNL THHNQQVFGP 

       490        500 
YYTEILKTLI SPAQALETKV ESV 

« Hide

Isoform 2 (TCP11d) [UniParc].

Checksum: 8775470FD36B5FD1
Show »

FASTA44149,329
Isoform 3 (TCP11c) [UniParc].

Checksum: C7D8BBBB6F1922A7
Show »

FASTA44049,500
Isoform 4 [UniParc].

Checksum: 2460B5E00F13D0BE
Show »

FASTA47052,445
Isoform 5 [UniParc].

Checksum: ED9D2E59F08B05B1
Show »

FASTA51156,857
Isoform 6 [UniParc].

Checksum: A4D107753A3D7BFE
Show »

FASTA46551,945
Isoform 7 [UniParc].

Checksum: 16C3FC861394C65F
Show »

FASTA51657,359

References

« Hide 'large scale' references
[1]"Molecular characterization of the TCP11 gene which is the human homologue of the mouse gene encoding the receptor of fertilization promoting peptide."
Ma Y., Zhang S., Xia Q., Zhang G., Huang X., Huang M., Xiao C., Pan A., Sun Y., Lebo R., Milunsky A.
Mol. Hum. Reprod. 8:24-31(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY.
Tissue: Testis.
[2]"Cloning, expression and alternative splicing of a novel isoform of human TCP11b gene."
Ma Y.X., Zhang S.Z., Wu Q.Q., Sun Y.
Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35:182-188(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Cloning, expression, and alternative splicing of the novel isoform of hTCP11 gene."
Ma Y.X., Zhang S.Z., Wu Q.Q., Sun Y., Qiu W.M., Xu W.M.
Zhongguo Yi Xue Ke Xue Yuan Xue Bao 25:122-128(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4; 5 AND 6), VARIANT ALA-253.
Tissue: Testis.
[5]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Brain and Testis.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF269223 mRNA. Translation: AAF75551.1.
AY069943 mRNA. Translation: AAL58042.1.
AF260330 mRNA. Translation: AAF91370.1.
AF536532 mRNA. Translation: AAN04044.1.
AF536533 mRNA. Translation: AAN04045.1.
AK057234 mRNA. Translation: BAG51889.1.
AK301975 mRNA. Translation: BAH13597.1.
AK315078 mRNA. Translation: BAG37546.1.
AK301778 mRNA. Translation: BAH13551.1.
AK302022 mRNA. Translation: BAH13610.1.
AK302456 mRNA. Translation: BAH13714.1.
AL138721 Genomic DNA. Translation: CAI12438.1.
CH471081 Genomic DNA. Translation: EAX03808.1.
CH471081 Genomic DNA. Translation: EAX03809.1.
BC033729 mRNA. Translation: AAH33729.1.
BC040003 mRNA. Translation: AAH40003.1.
BC048418 mRNA. Translation: AAH48418.1.
BC090050 mRNA. Translation: AAH90050.1.
CCDSCCDS47413.1. [Q8WWU5-7]
CCDS4799.1. [Q8WWU5-2]
CCDS59015.1. [Q8WWU5-3]
CCDS59016.1. [Q8WWU5-6]
CCDS59017.1. [Q8WWU5-4]
CCDS59018.1. [Q8WWU5-5]
RefSeqNP_001087197.1. NM_001093728.2. [Q8WWU5-7]
NP_001248746.1. NM_001261817.1. [Q8WWU5-5]
NP_001248747.1. NM_001261818.1. [Q8WWU5-4]
NP_001248748.1. NM_001261819.1. [Q8WWU5-6]
NP_001248749.1. NM_001261820.1. [Q8WWU5-3]
NP_001248750.1. NM_001261821.1. [Q8WWU5-3]
NP_061149.1. NM_018679.5. [Q8WWU5-2]
XP_005249394.1. XM_005249337.2. [Q8WWU5-2]
XP_005249395.1. XM_005249338.2. [Q8WWU5-3]
XP_006715236.1. XM_006715173.1. [Q8WWU5-3]
UniGeneHs.435371.

3D structure databases

ProteinModelPortalQ8WWU5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid112814. 3 interactions.
IntActQ8WWU5. 2 interactions.
STRING9606.ENSP00000308708.

PTM databases

PhosphoSiteQ8WWU5.

Polymorphism databases

DMDM74716246.

Proteomic databases

PaxDbQ8WWU5.
PRIDEQ8WWU5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000244645; ENSP00000244645; ENSG00000124678. [Q8WWU5-2]
ENST00000311875; ENSP00000308708; ENSG00000124678. [Q8WWU5-7]
ENST00000373974; ENSP00000363085; ENSG00000124678. [Q8WWU5-4]
ENST00000373979; ENSP00000363091; ENSG00000124678. [Q8WWU5-2]
ENST00000412155; ENSP00000402816; ENSG00000124678. [Q8WWU5-6]
ENST00000418521; ENSP00000415320; ENSG00000124678. [Q8WWU5-3]
ENST00000444780; ENSP00000404479; ENSG00000124678. [Q8WWU5-5]
ENST00000512012; ENSP00000425995; ENSG00000124678. [Q8WWU5-1]
GeneID6954.
KEGGhsa:6954.
UCSCuc003ojz.1. human. [Q8WWU5-2]
uc003okb.2. human. [Q8WWU5-1]
uc011dsw.1. human.

Organism-specific databases

CTD6954.
GeneCardsGC06M035240.
HGNCHGNC:11658. TCP11.
MIM186982. gene.
neXtProtNX_Q8WWU5.
PharmGKBPA36409.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG257003.
HOVERGENHBG008348.
InParanoidQ8WWU5.
OMANLTHHNQ.
OrthoDBEOG77126P.
PhylomeDBQ8WWU5.
TreeFamTF313385.

Gene expression databases

ArrayExpressQ8WWU5.
BgeeQ8WWU5.
CleanExHS_TCP11.
GenevestigatorQ8WWU5.

Family and domain databases

InterProIPR008862. Tcp11.
[Graphical view]
PANTHERPTHR12832. PTHR12832. 1 hit.
PfamPF05794. Tcp11. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiTCP11.
GenomeRNAi6954.
NextBio27231.
PROQ8WWU5.
SOURCESearch...

Entry information

Entry nameTCP11_HUMAN
AccessionPrimary (citable) accession number: Q8WWU5
Secondary accession number(s): B2RCE9 expand/collapse secondary AC list , B3KQ27, B7Z7B5, B7Z7G1, B7Z7H4, B7Z7S8, E7EP29, J3KNG1, Q8NF85, Q9NQZ9, Q9NR39
Entry history
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2002
Last modified: July 9, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM