Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ataxin-2-like protein

Gene

ATXN2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the regulation of stress granule and P-body formation.1 Publication

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

  • regulation of cytoplasmic mRNA processing body assembly Source: UniProtKB
  • stress granule assembly Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

SignaLinkiQ8WWM7.
SIGNORiQ8WWM7.

Names & Taxonomyi

Protein namesi
Recommended name:
Ataxin-2-like protein
Alternative name(s):
Ataxin-2 domain protein
Ataxin-2-related protein
Gene namesi
Name:ATXN2L
Synonyms:A2D, A2LG, A2LP, A2RP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:31326. ATXN2L.

Subcellular locationi

GO - Cellular componenti

  • cell-cell adherens junction Source: BHF-UCL
  • cytoplasm Source: HPA
  • cytoplasmic stress granule Source: UniProtKB
  • membrane Source: UniProtKB
  • nuclear speck Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi361 – 3611R → Q: No effect on localization to stress granules under stress conditions. 1 Publication
Mutagenesisi370 – 3701R → Q: No effect on localization to stress granules under stress conditions. 1 Publication

Organism-specific databases

PharmGKBiPA128394585.

Polymorphism and mutation databases

BioMutaiATXN2L.
DMDMi52000729.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10751075Ataxin-2-like proteinPRO_0000064754Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources1 Publication
Modified residuei103 – 1031PhosphoserineCombined sources
Modified residuei111 – 1111PhosphoserineCombined sources
Modified residuei118 – 1181PhosphotyrosineCombined sources
Modified residuei207 – 2071N6-acetyllysineBy similarity
Modified residuei238 – 2381PhosphoserineCombined sources
Modified residuei264 – 2641PhosphotyrosineCombined sources
Modified residuei306 – 3061PhosphoserineCombined sources
Modified residuei309 – 3091PhosphotyrosineCombined sources
Modified residuei335 – 3351PhosphoserineCombined sources
Modified residuei339 – 3391PhosphoserineCombined sources
Modified residuei349 – 3491PhosphotyrosineCombined sources
Modified residuei361 – 3611Asymmetric dimethylarginine1 Publication
Modified residuei391 – 3911PhosphoserineCombined sources
Modified residuei409 – 4091PhosphoserineCombined sources
Modified residuei449 – 4491PhosphoserineCombined sources
Modified residuei493 – 4931PhosphoserineCombined sources
Modified residuei496 – 4961PhosphoserineCombined sources
Modified residuei557 – 5571PhosphoserineBy similarity
Modified residuei558 – 5581PhosphoserineCombined sources
Modified residuei559 – 5591PhosphoserineCombined sources
Modified residuei563 – 5631PhosphoserineCombined sources
Modified residuei594 – 5941PhosphoserineCombined sources
Modified residuei632 – 6321PhosphothreonineCombined sources
Modified residuei634 – 6341PhosphoserineCombined sources
Modified residuei674 – 6741PhosphoserineCombined sources
Modified residuei680 – 6801PhosphoserineCombined sources
Modified residuei684 – 6841PhosphoserineCombined sources

Post-translational modificationi

Thrombopoietin triggers the phosphorylation on tyrosine residues in a way that is dependent on MPL C-terminal domain.1 Publication
Asymmetrically dimethylated. Probably methylated by PRMT1.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiQ8WWM7.
MaxQBiQ8WWM7.
PaxDbiQ8WWM7.
PeptideAtlasiQ8WWM7.
PRIDEiQ8WWM7.

PTM databases

iPTMnetiQ8WWM7.
PhosphoSiteiQ8WWM7.

Miscellaneous databases

PMAP-CutDBQ8WWM7.

Expressioni

Tissue specificityi

Expressed at high levels in thymus, lymph node, spleen, fetal kidney and adult testis. Constitutively associated with MPL and EPOR in hematopoietic cells.1 Publication

Gene expression databases

BgeeiENSG00000168488.
ExpressionAtlasiQ8WWM7. baseline and differential.
GenevisibleiQ8WWM7. HS.

Organism-specific databases

HPAiHPA041506.
HPA043391.
HPA071955.

Interactioni

Subunit structurei

Interacts with MPL/TPOR and EPOR and dissociates after ligand stimulation (PubMed:11784712). Interacts with DDX6, G3BP1, and ATXN2 (PubMed:23209657). Interacts with PRMT1 (PubMed:25748791). Interacts with CIC and ATXN1 (By similarity).By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
EPORP192352EBI-948363,EBI-617321
G3BP1Q132835EBI-948363,EBI-1047359

GO - Molecular functioni

  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL

Protein-protein interaction databases

BioGridi116429. 39 interactions.
IntActiQ8WWM7. 40 interactions.
MINTiMINT-2869607.
STRINGi9606.ENSP00000378917.

Structurei

3D structure databases

ProteinModelPortaliQ8WWM7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni98 – 12124Interaction with MPLAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi4 – 8481Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the ataxin-2 family.Curated

Phylogenomic databases

eggNOGiKOG2375. Eukaryota.
COG5180. LUCA.
GeneTreeiENSGT00530000063565.
HOGENOMiHOG000234354.
HOVERGENiHBG050623.
InParanoidiQ8WWM7.
OMAiYIGHPQV.
OrthoDBiEOG091G01U5.
PhylomeDBiQ8WWM7.
TreeFamiTF326591.

Family and domain databases

InterProiIPR009818. Ataxin-2_C.
IPR009604. LsmAD_domain.
IPR025852. SM_dom_ATX.
[Graphical view]
PfamiPF06741. LsmAD. 1 hit.
PF07145. PAM2. 1 hit.
PF14438. SM-ATX. 1 hit.
[Graphical view]
SMARTiSM01272. LsmAD. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WWM7-1) [UniParc]FASTAAdd to basket
Also known as: A2D-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLKPQPLQQP SQPQQPPPTQ QAVARRPPGG TSPPNGGLPG PLATSAAPPG
60 70 80 90 100
PPAAASPCLG PVAAAGSGLR RGAEGILAPQ PPPPQQHQER PGAAAIGSAR
110 120 130 140 150
GQSTGKGPPQ SPVFEGVYNN SRMLHFLTAV VGSTCDVKVK NGTTYEGIFK
160 170 180 190 200
TLSSKFELAV DAVHRKASEP AGGPRREDIV DTMVFKPSDV MLVHFRNVDF
210 220 230 240 250
NYATKDKFTD SAIAMNSKVN GEHKEKVLQR WEGGDSNSDD YDLESDMSNG
260 270 280 290 300
WDPNEMFKFN EENYGVKTTY DSSLSSYTVP LEKDNSEEFR QRELRAAQLA
310 320 330 340 350
REIESSPQYR LRIAMENDDG RTEEEKHSAV QRQGSGRESP SLASREGKYI
360 370 380 390 400
PLPQRVREGP RGGVRCSSSR GGRPGLSSLP PRGPHHLDNS SPGPGSEARG
410 420 430 440 450
INGGPSRMSP KAQRPLRGAK TLSSPSNRPS GETSVPPPPA VGRMYPPRSP
460 470 480 490 500
KSAAPAPISA SCPEPPIGSA VPTSSASIPV TSSVSDPGVG SISPASPKIS
510 520 530 540 550
LAPTDVKELS TKEPGRTLEP QELARIAGKV PGLQNEQKRF QLEELRKFGA
560 570 580 590 600
QFKLQPSSSP ENSLDPFPPR ILKEEPKGKE KEVDGLLTSE PMGSPVSSKT
610 620 630 640 650
ESVSDKEDKP PLAPSGGTEG PEQPPPPCPS QTGSPPVGLI KGEDKDEGPV
660 670 680 690 700
AEQVKKSTLN PNAKEFNPTK PLLSVNKSTS TPTSPGPRTH STPSIPVLTA
710 720 730 740 750
GQSGLYSPQY ISYIPQIHMG PAVQAPQMYP YPVSNSVPGQ QGKYRGAKGS
760 770 780 790 800
LPPQRSDQHQ PASAPPMMQA AAAAGPPLVA ATPYSSYIPY NPQQFPGQPA
810 820 830 840 850
MMQPMAHYPS QPVFAPMLQS NPRMLTSGSH PQAIVSSSTP QYPSAEQPTP
860 870 880 890 900
QALYATVHQS YPHHATQLHA HQPQPATTPT GSQPQSQHAA PSPVQHQAGQ
910 920 930 940 950
APHLGSGQPQ QNLYHPGALT GTPPSLPPGP SAQSPQSSFP QPAAVYAIHH
960 970 980 990 1000
QQLPHGFTNM AHVTQAHVQT GITAAPPPHP GAPHPPQVML LHPPQSHGGP
1010 1020 1030 1040 1050
PQGAVPQSGV PALSASTPSP YPYIGHPQGE QPGQAPGFPG GADDRIREFS
1060 1070
LAGGIWHGRA EGLQVGQDAR VLGGE
Length:1,075
Mass (Da):113,374
Last modified:September 13, 2004 - v2
Checksum:i805E8B02E853C20E
GO
Isoform 2 (identifier: Q8WWM7-2) [UniParc]FASTAAdd to basket
Also known as: A2D-B

The sequence of this isoform differs from the canonical sequence as follows:
     1047-1075: REFSLAGGIWHGRAEGLQVGQDARVLGGE → PPLPPPGELKIVLAAT

Show »
Length:1,062
Mass (Da):111,920
Checksum:iB054BFABDF7C093D
GO
Isoform 3 (identifier: Q8WWM7-3) [UniParc]FASTAAdd to basket
Also known as: A2D-C

The sequence of this isoform differs from the canonical sequence as follows:
     1047-1075: REFSLAGGIWHGRAEGLQVGQDARVLGGE → LCRVGRSHSR...ALSDPDCLLT

Show »
Length:1,097
Mass (Da):115,582
Checksum:i34435B16C34845BD
GO
Isoform 4 (identifier: Q8WWM7-4) [UniParc]FASTAAdd to basket
Also known as: A2D-D

The sequence of this isoform differs from the canonical sequence as follows:
     1029-1075: GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE → VQSHPSQQLPFHPPGN

Show »
Length:1,044
Mass (Da):110,326
Checksum:iFD514C5B1780634A
GO
Isoform 5 (identifier: Q8WWM7-5) [UniParc]FASTAAdd to basket
Also known as: A2D-E

The sequence of this isoform differs from the canonical sequence as follows:
     1029-1075: GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE → APFPPPGELKIVLAAT

Show »
Length:1,044
Mass (Da):110,177
Checksum:i2EB33B345AC1E74D
GO
Isoform 6 (identifier: Q8WWM7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     896-967: HQAGQAPHLG...TNMAHVTQAH → VPAMGGAEWS...HSRICTTQGP
     968-1075: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:968
Mass (Da):102,895
Checksum:iBB93E110396C536A
GO
Isoform 7 (identifier: Q8WWM7-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-400: QRVREGPRGG...SPGPGSEARG → HRGQGQGPAG...DGRSFIFYYL
     401-1075: Missing.

Note: No experimental confirmation available.
Show »
Length:399
Mass (Da):42,995
Checksum:i1D94FCE52DE4B460
GO
Isoform 8 (identifier: Q8WWM7-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1029-1075: GEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE → APLPPPGELKIVLAAT

Show »
Length:1,044
Mass (Da):110,143
Checksum:i2EB33B345AC9454D
GO
Isoform 9 (identifier: Q8WWM7-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1047-1075: REFSLAGGIWHGRAEGLQVGQDARVLGGE → LQSHPSQQLPFHPPGN

Show »
Length:1,062
Mass (Da):112,091
Checksum:iE5A6C8C492352F33
GO

Sequence cautioni

The sequence AAC69607 differs from that shown. Reason: Frameshift at positions 31, 429, 432 and 446. Curated
The sequence AAO12056 differs from that shown. Reason: Frameshift at several positions. Curated
The sequence AAO12057 differs from that shown. Reason: Frameshift at several positions. Curated
The sequence AAO12058 differs from that shown.Exon duplication.Curated
The sequence AAO12058 differs from that shown. Reason: Frameshift at several positions. Curated
The sequence AAO12059 differs from that shown.Exon duplication.Curated
The sequence AAO12059 differs from that shown. Reason: Frameshift at several positions. Curated
The sequence AAO12060 differs from that shown.Exon duplication.Curated
The sequence AAO12060 differs from that shown. Reason: Frameshift at several positions. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti337 – 3371R → RG in AAB19201 (PubMed:8896555).Curated
Sequence conflicti689 – 6891T → S in CAC38068 (PubMed:11784712).Curated
Sequence conflicti689 – 6891T → S in CAC38069 (PubMed:11784712).Curated
Sequence conflicti689 – 6891T → S in CAC38070 (PubMed:11784712).Curated
Sequence conflicti689 – 6891T → S in CAC38071 (PubMed:11784712).Curated
Sequence conflicti689 – 6891T → S in CAC38072 (PubMed:11784712).Curated
Sequence conflicti726 – 7261P → T in CAC38068 (PubMed:11784712).Curated
Sequence conflicti726 – 7261P → T in CAC38069 (PubMed:11784712).Curated
Sequence conflicti726 – 7261P → T in CAC38070 (PubMed:11784712).Curated
Sequence conflicti726 – 7261P → T in CAC38071 (PubMed:11784712).Curated
Sequence conflicti726 – 7261P → T in CAC38072 (PubMed:11784712).Curated
Sequence conflicti895 – 8951Q → QQ in AAH10239 (PubMed:15489334).Curated
Isoform 2 (identifier: Q8WWM7-2)
Sequence conflicti1049 – 10491L → F in CAC38069 (PubMed:11784712).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei354 – 40047QRVRE…SEARG → HRGQGQGPAGVGGSCSAPAR PHPVLPSHPLIYSPAGDGRS FIFYYL in isoform 7. 1 PublicationVSP_011587Add
BLAST
Alternative sequencei401 – 1075675Missing in isoform 7. 1 PublicationVSP_011588Add
BLAST
Alternative sequencei896 – 96772HQAGQ…VTQAH → VPAMGGAEWSWCRNGWPEEG IELGVISEWRGLGASELLAC VALNLPLPSSIRRGRPHTWA VDSHSRICTTQGP in isoform 6. 1 PublicationVSP_011589Add
BLAST
Alternative sequencei968 – 1075108Missing in isoform 6. 1 PublicationVSP_011590Add
BLAST
Alternative sequencei1029 – 107547GEQPG…VLGGE → VQSHPSQQLPFHPPGN in isoform 4. 2 PublicationsVSP_011591Add
BLAST
Alternative sequencei1029 – 107547GEQPG…VLGGE → APFPPPGELKIVLAAT in isoform 5. 1 PublicationVSP_011592Add
BLAST
Alternative sequencei1029 – 107547GEQPG…VLGGE → APLPPPGELKIVLAAT in isoform 8. 1 PublicationVSP_044243Add
BLAST
Alternative sequencei1047 – 107529REFSL…VLGGE → PPLPPPGELKIVLAAT in isoform 2. 1 PublicationVSP_011593Add
BLAST
Alternative sequencei1047 – 107529REFSL…VLGGE → LCRVGRSHSRRRQGLAPGSV LCFPPSSLSCDPAAPLPTAS PALSDPDCLLT in isoform 3. 1 PublicationVSP_011594Add
BLAST
Alternative sequencei1047 – 107529REFSL…VLGGE → LQSHPSQQLPFHPPGN in isoform 9. 1 PublicationVSP_047122Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ317970 mRNA. Translation: CAC38068.1.
AJ317971 mRNA. Translation: CAC38069.3.
AJ317972 mRNA. Translation: CAC38070.3.
AJ317973 mRNA. Translation: CAC38071.3.
AJ317974 mRNA. Translation: CAC38072.3.
AY188334 mRNA. Translation: AAO12056.1. Frameshift.
AY188335 mRNA. Translation: AAO12057.1. Frameshift.
AY188336 mRNA. Translation: AAO12058.1. Sequence problems.
AY188337 mRNA. Translation: AAO12059.1. Sequence problems.
AY188338 mRNA. Translation: AAO12060.1. Sequence problems.
AF034373 mRNA. Translation: AAC69607.1. Frameshift.
AK289981 mRNA. Translation: BAF82670.1.
AC116346 Genomic DNA. No translation available.
AC133550 Genomic DNA. No translation available.
AC145285 Genomic DNA. No translation available.
BC010239 mRNA. Translation: AAH10239.1.
BC068012 mRNA. Translation: AAH68012.1. Sequence problems.
BC082760 mRNA. Translation: AAH82760.1.
BC136584 mRNA. Translation: AAI36585.1.
U70671 mRNA. Translation: AAB19201.1.
CCDSiCCDS10639.1. [Q8WWM7-4]
CCDS10640.1. [Q8WWM7-3]
CCDS10641.1. [Q8WWM7-1]
CCDS32423.1. [Q8WWM7-2]
CCDS45451.1. [Q8WWM7-8]
CCDS58443.1. [Q8WWM7-9]
RefSeqiNP_009176.2. NM_007245.3. [Q8WWM7-1]
NP_059867.3. NM_017492.3. [Q8WWM7-9]
NP_663760.1. NM_145714.2. [Q8WWM7-2]
NP_680780.1. NM_148414.2. [Q8WWM7-3]
NP_680781.1. NM_148415.2. [Q8WWM7-4]
NP_680782.1. NM_148416.2. [Q8WWM7-8]
XP_005255123.1. XM_005255066.1. [Q8WWM7-3]
UniGeneiHs.460499.

Genome annotation databases

EnsembliENST00000325215; ENSP00000315650; ENSG00000168488. [Q8WWM7-2]
ENST00000336783; ENSP00000338718; ENSG00000168488. [Q8WWM7-1]
ENST00000340394; ENSP00000341459; ENSG00000168488. [Q8WWM7-4]
ENST00000382686; ENSP00000372133; ENSG00000168488. [Q8WWM7-8]
ENST00000395547; ENSP00000378917; ENSG00000168488. [Q8WWM7-3]
ENST00000570200; ENSP00000454516; ENSG00000168488. [Q8WWM7-9]
GeneIDi11273.
KEGGihsa:11273.
UCSCiuc002dqy.5. human. [Q8WWM7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ317970 mRNA. Translation: CAC38068.1.
AJ317971 mRNA. Translation: CAC38069.3.
AJ317972 mRNA. Translation: CAC38070.3.
AJ317973 mRNA. Translation: CAC38071.3.
AJ317974 mRNA. Translation: CAC38072.3.
AY188334 mRNA. Translation: AAO12056.1. Frameshift.
AY188335 mRNA. Translation: AAO12057.1. Frameshift.
AY188336 mRNA. Translation: AAO12058.1. Sequence problems.
AY188337 mRNA. Translation: AAO12059.1. Sequence problems.
AY188338 mRNA. Translation: AAO12060.1. Sequence problems.
AF034373 mRNA. Translation: AAC69607.1. Frameshift.
AK289981 mRNA. Translation: BAF82670.1.
AC116346 Genomic DNA. No translation available.
AC133550 Genomic DNA. No translation available.
AC145285 Genomic DNA. No translation available.
BC010239 mRNA. Translation: AAH10239.1.
BC068012 mRNA. Translation: AAH68012.1. Sequence problems.
BC082760 mRNA. Translation: AAH82760.1.
BC136584 mRNA. Translation: AAI36585.1.
U70671 mRNA. Translation: AAB19201.1.
CCDSiCCDS10639.1. [Q8WWM7-4]
CCDS10640.1. [Q8WWM7-3]
CCDS10641.1. [Q8WWM7-1]
CCDS32423.1. [Q8WWM7-2]
CCDS45451.1. [Q8WWM7-8]
CCDS58443.1. [Q8WWM7-9]
RefSeqiNP_009176.2. NM_007245.3. [Q8WWM7-1]
NP_059867.3. NM_017492.3. [Q8WWM7-9]
NP_663760.1. NM_145714.2. [Q8WWM7-2]
NP_680780.1. NM_148414.2. [Q8WWM7-3]
NP_680781.1. NM_148415.2. [Q8WWM7-4]
NP_680782.1. NM_148416.2. [Q8WWM7-8]
XP_005255123.1. XM_005255066.1. [Q8WWM7-3]
UniGeneiHs.460499.

3D structure databases

ProteinModelPortaliQ8WWM7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116429. 39 interactions.
IntActiQ8WWM7. 40 interactions.
MINTiMINT-2869607.
STRINGi9606.ENSP00000378917.

PTM databases

iPTMnetiQ8WWM7.
PhosphoSiteiQ8WWM7.

Polymorphism and mutation databases

BioMutaiATXN2L.
DMDMi52000729.

Proteomic databases

EPDiQ8WWM7.
MaxQBiQ8WWM7.
PaxDbiQ8WWM7.
PeptideAtlasiQ8WWM7.
PRIDEiQ8WWM7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325215; ENSP00000315650; ENSG00000168488. [Q8WWM7-2]
ENST00000336783; ENSP00000338718; ENSG00000168488. [Q8WWM7-1]
ENST00000340394; ENSP00000341459; ENSG00000168488. [Q8WWM7-4]
ENST00000382686; ENSP00000372133; ENSG00000168488. [Q8WWM7-8]
ENST00000395547; ENSP00000378917; ENSG00000168488. [Q8WWM7-3]
ENST00000570200; ENSP00000454516; ENSG00000168488. [Q8WWM7-9]
GeneIDi11273.
KEGGihsa:11273.
UCSCiuc002dqy.5. human. [Q8WWM7-1]

Organism-specific databases

CTDi11273.
GeneCardsiATXN2L.
HGNCiHGNC:31326. ATXN2L.
HPAiHPA041506.
HPA043391.
HPA071955.
MIMi607931. gene.
neXtProtiNX_Q8WWM7.
PharmGKBiPA128394585.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2375. Eukaryota.
COG5180. LUCA.
GeneTreeiENSGT00530000063565.
HOGENOMiHOG000234354.
HOVERGENiHBG050623.
InParanoidiQ8WWM7.
OMAiYIGHPQV.
OrthoDBiEOG091G01U5.
PhylomeDBiQ8WWM7.
TreeFamiTF326591.

Enzyme and pathway databases

SignaLinkiQ8WWM7.
SIGNORiQ8WWM7.

Miscellaneous databases

GeneWikiiATXN2L.
GenomeRNAii11273.
PMAP-CutDBQ8WWM7.
PROiQ8WWM7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168488.
ExpressionAtlasiQ8WWM7. baseline and differential.
GenevisibleiQ8WWM7. HS.

Family and domain databases

InterProiIPR009818. Ataxin-2_C.
IPR009604. LsmAD_domain.
IPR025852. SM_dom_ATX.
[Graphical view]
PfamiPF06741. LsmAD. 1 hit.
PF07145. PAM2. 1 hit.
PF14438. SM-ATX. 1 hit.
[Graphical view]
SMARTiSM01272. LsmAD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiATX2L_HUMAN
AccessioniPrimary (citable) accession number: Q8WWM7
Secondary accession number(s): A8K1R6
, B9EGM2, E9PAR9, O95135, Q63ZY4, Q6NVJ8, Q6PJW6, Q8IU61, Q8IU95, Q8WWM3, Q8WWM4, Q8WWM5, Q8WWM6, Q99703
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: September 13, 2004
Last modified: September 7, 2016
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.