Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WWK9

- CKAP2_HUMAN

UniProt

Q8WWK9 - CKAP2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cytoskeleton-associated protein 2

Gene

CKAP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Possesses microtubule stabilizing properties. Involved in regulating aneuploidy, cell cycling, and cell death in a p53/TP53-dependent manner (By similarity).By similarity

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. mitotic cytokinesis Source: MGI
  3. negative regulation of microtubule depolymerization Source: Ensembl
  4. positive regulation of transcription from RNA polymerase II promoter Source: MGI
Complete GO annotation...

Keywords - Biological processi

Apoptosis, Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Cytoskeleton-associated protein 2
Alternative name(s):
CTCL tumor antigen se20-10
Tumor- and microtubule-associated protein
Gene namesi
Name:CKAP2Imported
Synonyms:LB1Imported, TMAPImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 13

Organism-specific databases

HGNCiHGNC:1990. CKAP2.

Subcellular locationi

Cytoplasmcytoskeleton. Cytoplasmcytoskeletonspindle. Cytoplasmcytoskeletonspindle pole
Note: Contrary to the ectopically expressed protein, endogenous CKAP2 does not colocalize with microtubules in G1, S and early G2. At late G2 and prophase after separation of duplicated centrosomes, colocalizes with gamma-tubulin and centrosome-proximal microtubules. From prometaphase through anaphase B, colocalizes with mitotic spindle poles and spindle microtubules. During cytokinesis, absent from midbody microtubules.

GO - Cellular componenti

  1. centrosome Source: UniProtKB
  2. cytoplasmic microtubule Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26526.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 683683Cytoskeleton-associated protein 2PRO_0000245774Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei534 – 5341Phosphoserine1 Publication
Modified residuei579 – 5791Phosphothreonine1 Publication
Modified residuei582 – 5821Phosphothreonine1 Publication
Modified residuei595 – 5951Phosphoserine2 Publications
Modified residuei596 – 5961Phosphothreonine1 Publication
Modified residuei597 – 5971Phosphothreonine3 Publications
Modified residuei599 – 5991Phosphotyrosine1 Publication
Modified residuei602 – 6021Phosphoserine3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8WWK9.
PaxDbiQ8WWK9.
PRIDEiQ8WWK9.

PTM databases

PhosphoSiteiQ8WWK9.

Expressioni

Tissue specificityi

Abundant in testis, thymus, and in tumor derived cell lines, while barely detectable in liver, prostate, and kidney.1 Publication

Developmental stagei

Present at the G1/S boundary. Accumulates as cells progress from S to G2 into mitosis. Rapidly degraded during mitosis exit by CDH1-activated anaphase promoting complex/cyclosome (APC/C).1 Publication

Inductioni

Up-regulated in primary human gastric cancers.1 Publication

Gene expression databases

BgeeiQ8WWK9.
ExpressionAtlasiQ8WWK9. baseline and differential.
GenevestigatoriQ8WWK9.

Organism-specific databases

HPAiHPA008410.
HPA027821.

Interactioni

Subunit structurei

Associates with alpha- and beta-tubulins.By similarity

Protein-protein interaction databases

BioGridi117755. 5 interactions.
IntActiQ8WWK9. 2 interactions.
MINTiMINT-4989610.

Structurei

3D structure databases

ProteinModelPortaliQ8WWK9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CKAP2 family.Curated

Phylogenomic databases

eggNOGiNOG25272.
GeneTreeiENSGT00530000063691.
HOVERGENiHBG107703.
InParanoidiQ8WWK9.
KOiK16769.
OMAiKQMTTEK.
OrthoDBiEOG7X9G6M.
PhylomeDBiQ8WWK9.
TreeFamiTF333003.

Family and domain databases

InterProiIPR029197. CKAP2_C.
IPR026165. CKAP2_fam.
[Graphical view]
PANTHERiPTHR16076. PTHR16076. 1 hit.
PfamiPF15297. CKAP2_C. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 13 Publications (identifier: Q8WWK9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTPAVPQDL QLPPSQRAQS AFKEQRRQKL KEHLLRRKTL FAYKQENEML
60 70 80 90 100
SSSRDQRVVT SEDQVQEGTK VLKLKTKMAD KENMKRPAES KNNTVVGKHC
110 120 130 140 150
IPLKPSNELT NSTVVIDTHK PKDSNQTPHL LLTEDDPQSQ HMTLSQAFHL
160 170 180 190 200
KNNSKKKQMT TEKQKQDANM PKKPVLGSYR GQIVQSKINS FRKPLQVKDE
210 220 230 240 250
SSAATKKLSA TIPKATKPQP VNTSSVTVKS NRSSNMTATT KFVSTTSQNT
260 270 280 290 300
QLVRPPIRSH HSNTRDTVKQ GISRTSANVT IRKGPHEKEL LQSKTALSSV
310 320 330 340 350
KTSSSQGIIR NKTLSRSIAS EVIARPASLS NDKLMEKSEP VDQRRHTAGK
360 370 380 390 400
AIVDSRSAQP KETSEERKAR LSEWKAGKGR VLKRPPNSVV TQHEPAGQNE
410 420 430 440 450
KPVGSFWTTM AEEDEQRLFT EKVNNTFSEC LNLINEGCPK EDILVTLNDL
460 470 480 490 500
IKNIPDAKKL VKYWICLALI EPITSPIENI IAIYEKAILA GAQPIEEMRH
510 520 530 540 550
TIVDILTMKS QEKANLGENM EKSCASKEEV KEVSIEDTGV DVDPEKLEME
560 570 580 590 600
SKLHRNLLFQ DCEKEQDNKT KDPTHDVKTP NTETRTSCLI KYNVSTTPYL
610 620 630 640 650
QSVKKKVQFD GTNSAFKELK FLTPVRRSRR LQEKTSKLPD MLKDHYPCVS
660 670 680
SLEQLTELGR ETDAFVCRPN AALCRVYYEA DTT
Length:683
Mass (Da):76,987
Last modified:March 1, 2002 - v1
Checksum:i15287A7D860A4B23
GO
Isoform 2 (identifier: Q8WWK9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-53: Missing.
     494-495: PI → VR
     496-683: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:494
Mass (Da):55,307
Checksum:iDD773D8CC02C95B6
GO
Isoform 4 (identifier: Q8WWK9-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEMLS → ML

Show »
Length:634
Mass (Da):71,195
Checksum:i10E49DFCE41416C5
GO
Isoform 3 (identifier: Q8WWK9-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-53: Missing.

Note: No experimental confirmation available.

Show »
Length:682
Mass (Da):76,900
Checksum:i44F00A4FFEE1FD98
GO

Sequence cautioni

The sequence AAI05807.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence AAG33675.1 differs from that shown. Reason: Frameshift at position 604.
The sequence AAG33675.1 differs from that shown. Reason: Frameshift at position 607.
The sequence AAH10901.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAA91788.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti402 – 4021P → L in CAB66782. (PubMed:11230166)Curated
Sequence conflicti531 – 5311K → Q in BAA91788. (PubMed:14702039)Curated
Sequence conflicti531 – 5311K → R in BAB14345. (PubMed:14702039)Curated
Sequence conflicti559 – 5591F → L in BAB14345. (PubMed:14702039)Curated
Sequence conflicti577 – 5771V → A in BAB14345. (PubMed:14702039)Curated
Sequence conflicti643 – 6431K → R in BAA91788. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti236 – 2361M → K.1 Publication
Corresponds to variant rs35975899 [ dbSNP | Ensembl ].
VAR_054018
Natural varianti323 – 3231I → V.5 Publications
Corresponds to variant rs7335867 [ dbSNP | Ensembl ].
VAR_069359

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MSTPA…NEMLS → ML in isoform 4. 1 PublicationVSP_055686Add
BLAST
Alternative sequencei53 – 531Missing in isoform 2 and isoform 3. 3 PublicationsVSP_047100
Alternative sequencei494 – 4952PI → VR in isoform 2. 1 PublicationVSP_047101
Alternative sequencei496 – 683188Missing in isoform 2. 1 PublicationVSP_047102Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y15758 mRNA. Translation: CAC17466.1.
AJ429398 Genomic DNA. Translation: CAD22295.1.
AY062261 mRNA. Translation: AAL47212.1.
AY062262 mRNA. Translation: AAL47213.1.
AK001611 mRNA. Translation: BAA91788.1. Different initiation.
AK022982 mRNA. Translation: BAB14345.1.
AK299083 mRNA. Translation: BAG61147.1.
EF560732 mRNA. Translation: ABQ59042.1.
AL359513 Genomic DNA. Translation: CAH71660.2.
AL359513 Genomic DNA. Translation: CAH71661.2.
BC010901 mRNA. Translation: AAH10901.1. Different initiation.
BC105806 mRNA. Translation: AAI05807.1. Sequence problems.
BC130296 mRNA. Translation: AAI30297.1.
AF177227 mRNA. Translation: AAG33675.1. Frameshift.
AL136848 mRNA. Translation: CAB66782.2.
CCDSiCCDS41893.1. [Q8WWK9-1]
CCDS66557.1. [Q8WWK9-6]
CCDS73578.1. [Q8WWK9-4]
CCDS9435.1. [Q8WWK9-5]
RefSeqiNP_001091995.1. NM_001098525.2. [Q8WWK9-1]
NP_001273615.1. NM_001286686.1. [Q8WWK9-6]
NP_001273616.1. NM_001286687.1. [Q8WWK9-4]
NP_060674.3. NM_018204.4. [Q8WWK9-5]
UniGeneiHs.444028.
Hs.594461.

Genome annotation databases

EnsembliENST00000258607; ENSP00000258607; ENSG00000136108. [Q8WWK9-5]
ENST00000378034; ENSP00000367273; ENSG00000136108. [Q8WWK9-4]
ENST00000378037; ENSP00000367276; ENSG00000136108. [Q8WWK9-1]
ENST00000490903; ENSP00000417830; ENSG00000136108. [Q8WWK9-6]
GeneIDi26586.
KEGGihsa:26586.
UCSCiuc001vgv.2. human. [Q8WWK9-1]

Polymorphism databases

DMDMi74751579.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y15758 mRNA. Translation: CAC17466.1 .
AJ429398 Genomic DNA. Translation: CAD22295.1 .
AY062261 mRNA. Translation: AAL47212.1 .
AY062262 mRNA. Translation: AAL47213.1 .
AK001611 mRNA. Translation: BAA91788.1 . Different initiation.
AK022982 mRNA. Translation: BAB14345.1 .
AK299083 mRNA. Translation: BAG61147.1 .
EF560732 mRNA. Translation: ABQ59042.1 .
AL359513 Genomic DNA. Translation: CAH71660.2 .
AL359513 Genomic DNA. Translation: CAH71661.2 .
BC010901 mRNA. Translation: AAH10901.1 . Different initiation.
BC105806 mRNA. Translation: AAI05807.1 . Sequence problems.
BC130296 mRNA. Translation: AAI30297.1 .
AF177227 mRNA. Translation: AAG33675.1 . Frameshift.
AL136848 mRNA. Translation: CAB66782.2 .
CCDSi CCDS41893.1. [Q8WWK9-1 ]
CCDS66557.1. [Q8WWK9-6 ]
CCDS73578.1. [Q8WWK9-4 ]
CCDS9435.1. [Q8WWK9-5 ]
RefSeqi NP_001091995.1. NM_001098525.2. [Q8WWK9-1 ]
NP_001273615.1. NM_001286686.1. [Q8WWK9-6 ]
NP_001273616.1. NM_001286687.1. [Q8WWK9-4 ]
NP_060674.3. NM_018204.4. [Q8WWK9-5 ]
UniGenei Hs.444028.
Hs.594461.

3D structure databases

ProteinModelPortali Q8WWK9.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117755. 5 interactions.
IntActi Q8WWK9. 2 interactions.
MINTi MINT-4989610.

PTM databases

PhosphoSitei Q8WWK9.

Polymorphism databases

DMDMi 74751579.

Proteomic databases

MaxQBi Q8WWK9.
PaxDbi Q8WWK9.
PRIDEi Q8WWK9.

Protocols and materials databases

DNASUi 26586.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000258607 ; ENSP00000258607 ; ENSG00000136108 . [Q8WWK9-5 ]
ENST00000378034 ; ENSP00000367273 ; ENSG00000136108 . [Q8WWK9-4 ]
ENST00000378037 ; ENSP00000367276 ; ENSG00000136108 . [Q8WWK9-1 ]
ENST00000490903 ; ENSP00000417830 ; ENSG00000136108 . [Q8WWK9-6 ]
GeneIDi 26586.
KEGGi hsa:26586.
UCSCi uc001vgv.2. human. [Q8WWK9-1 ]

Organism-specific databases

CTDi 26586.
GeneCardsi GC13P053029.
HGNCi HGNC:1990. CKAP2.
HPAi HPA008410.
HPA027821.
MIMi 611569. gene.
neXtProti NX_Q8WWK9.
PharmGKBi PA26526.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG25272.
GeneTreei ENSGT00530000063691.
HOVERGENi HBG107703.
InParanoidi Q8WWK9.
KOi K16769.
OMAi KQMTTEK.
OrthoDBi EOG7X9G6M.
PhylomeDBi Q8WWK9.
TreeFami TF333003.

Miscellaneous databases

GeneWikii CKAP2.
GenomeRNAii 26586.
NextBioi 35474286.
PROi Q8WWK9.
SOURCEi Search...

Gene expression databases

Bgeei Q8WWK9.
ExpressionAtlasi Q8WWK9. baseline and differential.
Genevestigatori Q8WWK9.

Family and domain databases

InterProi IPR029197. CKAP2_C.
IPR026165. CKAP2_fam.
[Graphical view ]
PANTHERi PTHR16076. PTHR16076. 1 hit.
Pfami PF15297. CKAP2_C. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel cDNA, encoding a cytoskeletal associated protein, differentially expressed in diffuse large B-cell lymphomas."
    Maouche-Chretien L., Deleu N., Badoual C., Fraissignes P., Berger R., Gaulard P., Romeo P.H., Leroy-Viard K.
    Oncogene 17:1245-1251(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT VAL-323.
    Tissue: T-cellImported.
  2. "Evolutionarily-conserved gene CKAP2,located in region 13q14.3 of the human genome, is frequently rearranged in various tumors."
    Udina I.G., Baranova A.V., Kompaniytsev A.A., Sulimova G.E.
    Genetika 37:120-123(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
  3. "Up-regulation of cytoskeletal-associated protein 2 in primary human gastric adenocarcinomas."
    Bae C.-D., Sung Y.-S., Jeon S.-M., Suh Y., Yang H.-K., Kim Y.-I., Park K.-H., Choi J., Ahn G., Park J.
    J. Cancer Res. Clin. Oncol. 129:621-630(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBCELLULAR LOCATION, INDUCTION.
    Tissue: Cervix carcinomaImported.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT VAL-323.
    Tissue: TeratocarcinomaImported.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  6. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT VAL-323.
    Tissue: Bone marrowImported, Cerebellum and TestisImported.
  8. "Serological detection of cutaneous T-cell lymphoma-associated antigens."
    Eichmueller S., Usener D., Dummer R., Stein A., Thiel D., Schadendorf D.
    Proc. Natl. Acad. Sci. U.S.A. 98:629-634(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 38-683 (ISOFORM 1), VARIANTS LYS-236 AND VAL-323.
    Tissue: TestisImported.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 135-683 (ISOFORM 1), VARIANT VAL-323.
    Tissue: TestisImported.
  10. "CKAP2 is a spindle-associated protein degraded by APC/C-Cdh1 during mitotic exit."
    Seki A., Fang G.
    J. Biol. Chem. 282:15103-15113(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE.
  11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-579; THR-582; SER-595; THR-596; THR-597; TYR-599 AND SER-602, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-597 AND SER-602, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-534; SER-595; THR-597 AND SER-602, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCKAP2_HUMAN
AccessioniPrimary (citable) accession number: Q8WWK9
Secondary accession number(s): A2BDE0
, A5YM58, B4DR35, E9PD90, Q3KRA5, Q5VXB4, Q8IWV5, Q8IWV6, Q96FH9, Q9H012, Q9H0D0, Q9H988, Q9HC49, Q9NVG4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: March 1, 2002
Last modified: October 29, 2014
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3