Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WWK9

- CKAP2_HUMAN

UniProt

Q8WWK9 - CKAP2_HUMAN

Protein

Cytoskeleton-associated protein 2

Gene

CKAP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 1 (01 Mar 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Possesses microtubule stabilizing properties. Involved in regulating aneuploidy, cell cycling, and cell death in a p53/TP53-dependent manner By similarity.By similarity

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. mitotic cytokinesis Source: MGI
    3. negative regulation of microtubule depolymerization Source: Ensembl
    4. positive regulation of transcription from RNA polymerase II promoter Source: MGI

    Keywords - Biological processi

    Apoptosis, Cell cycle

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytoskeleton-associated protein 2
    Alternative name(s):
    CTCL tumor antigen se20-10
    Tumor- and microtubule-associated protein
    Gene namesi
    Name:CKAP2Imported
    Synonyms:LB1Imported, TMAPImported
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 13

    Organism-specific databases

    HGNCiHGNC:1990. CKAP2.

    Subcellular locationi

    Cytoplasmcytoskeleton. Cytoplasmcytoskeletonspindle. Cytoplasmcytoskeletonspindle pole
    Note: Contrary to the ectopically expressed protein, endogenous CKAP2 does not colocalize with microtubules in G1, S and early G2. At late G2 and prophase after separation of duplicated centrosomes, colocalizes with gamma-tubulin and centrosome-proximal microtubules. From prometaphase through anaphase B, colocalizes with mitotic spindle poles and spindle microtubules. During cytokinesis, absent from midbody microtubules.

    GO - Cellular componenti

    1. centrosome Source: UniProtKB
    2. cytoplasmic microtubule Source: Ensembl
    3. spindle pole Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Microtubule

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26526.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 683683Cytoskeleton-associated protein 2PRO_0000245774Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei534 – 5341Phosphoserine1 Publication
    Modified residuei579 – 5791Phosphothreonine1 Publication
    Modified residuei582 – 5821Phosphothreonine1 Publication
    Modified residuei595 – 5951Phosphoserine2 Publications
    Modified residuei596 – 5961Phosphothreonine1 Publication
    Modified residuei597 – 5971Phosphothreonine3 Publications
    Modified residuei599 – 5991Phosphotyrosine1 Publication
    Modified residuei602 – 6021Phosphoserine3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8WWK9.
    PaxDbiQ8WWK9.
    PRIDEiQ8WWK9.

    PTM databases

    PhosphoSiteiQ8WWK9.

    Expressioni

    Tissue specificityi

    Abundant in testis, thymus, and in tumor derived cell lines, while barely detectable in liver, prostate, and kidney.1 Publication

    Developmental stagei

    Present at the G1/S boundary. Accumulates as cells progress from S to G2 into mitosis. Rapidly degraded during mitosis exit by CDH1-activated anaphase promoting complex/cyclosome (APC/C).1 Publication

    Inductioni

    Up-regulated in primary human gastric cancers.1 Publication

    Gene expression databases

    ArrayExpressiQ8WWK9.
    BgeeiQ8WWK9.
    GenevestigatoriQ8WWK9.

    Organism-specific databases

    HPAiHPA008410.
    HPA027821.

    Interactioni

    Subunit structurei

    Associates with alpha- and beta-tubulins.By similarity

    Protein-protein interaction databases

    BioGridi117755. 3 interactions.
    IntActiQ8WWK9. 2 interactions.
    MINTiMINT-4989610.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8WWK9.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the CKAP2 family.Curated

    Phylogenomic databases

    eggNOGiNOG25272.
    HOVERGENiHBG107703.
    InParanoidiQ8WWK9.
    KOiK16769.
    OMAiKQMTTEK.
    OrthoDBiEOG7X9G6M.
    PhylomeDBiQ8WWK9.
    TreeFamiTF333003.

    Family and domain databases

    InterProiIPR029197. CKAP2_C.
    IPR026165. CKAP2_fam.
    [Graphical view]
    PANTHERiPTHR16076. PTHR16076. 1 hit.
    PfamiPF15297. CKAP2_C. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 13 Publications (identifier: Q8WWK9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSTPAVPQDL QLPPSQRAQS AFKEQRRQKL KEHLLRRKTL FAYKQENEML    50
    SSSRDQRVVT SEDQVQEGTK VLKLKTKMAD KENMKRPAES KNNTVVGKHC 100
    IPLKPSNELT NSTVVIDTHK PKDSNQTPHL LLTEDDPQSQ HMTLSQAFHL 150
    KNNSKKKQMT TEKQKQDANM PKKPVLGSYR GQIVQSKINS FRKPLQVKDE 200
    SSAATKKLSA TIPKATKPQP VNTSSVTVKS NRSSNMTATT KFVSTTSQNT 250
    QLVRPPIRSH HSNTRDTVKQ GISRTSANVT IRKGPHEKEL LQSKTALSSV 300
    KTSSSQGIIR NKTLSRSIAS EVIARPASLS NDKLMEKSEP VDQRRHTAGK 350
    AIVDSRSAQP KETSEERKAR LSEWKAGKGR VLKRPPNSVV TQHEPAGQNE 400
    KPVGSFWTTM AEEDEQRLFT EKVNNTFSEC LNLINEGCPK EDILVTLNDL 450
    IKNIPDAKKL VKYWICLALI EPITSPIENI IAIYEKAILA GAQPIEEMRH 500
    TIVDILTMKS QEKANLGENM EKSCASKEEV KEVSIEDTGV DVDPEKLEME 550
    SKLHRNLLFQ DCEKEQDNKT KDPTHDVKTP NTETRTSCLI KYNVSTTPYL 600
    QSVKKKVQFD GTNSAFKELK FLTPVRRSRR LQEKTSKLPD MLKDHYPCVS 650
    SLEQLTELGR ETDAFVCRPN AALCRVYYEA DTT 683
    Length:683
    Mass (Da):76,987
    Last modified:March 1, 2002 - v1
    Checksum:i15287A7D860A4B23
    GO
    Isoform 2 (identifier: Q8WWK9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         53-53: Missing.
         494-495: PI → VR
         496-683: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:494
    Mass (Da):55,307
    Checksum:iDD773D8CC02C95B6
    GO
    Isoform 4 (identifier: Q8WWK9-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEMLS → ML

    Show »
    Length:634
    Mass (Da):71,195
    Checksum:i10E49DFCE41416C5
    GO
    Isoform 3 (identifier: Q8WWK9-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         53-53: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:682
    Mass (Da):76,900
    Checksum:i44F00A4FFEE1FD98
    GO

    Sequence cautioni

    The sequence AAI05807.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence AAG33675.1 differs from that shown. Reason: Frameshift at position 604.
    The sequence AAG33675.1 differs from that shown. Reason: Frameshift at position 607.
    The sequence AAH10901.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAA91788.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti402 – 4021P → L in CAB66782. (PubMed:11230166)Curated
    Sequence conflicti531 – 5311K → Q in BAA91788. (PubMed:14702039)Curated
    Sequence conflicti531 – 5311K → R in BAB14345. (PubMed:14702039)Curated
    Sequence conflicti559 – 5591F → L in BAB14345. (PubMed:14702039)Curated
    Sequence conflicti577 – 5771V → A in BAB14345. (PubMed:14702039)Curated
    Sequence conflicti643 – 6431K → R in BAA91788. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti236 – 2361M → K.1 Publication
    Corresponds to variant rs35975899 [ dbSNP | Ensembl ].
    VAR_054018
    Natural varianti323 – 3231I → V.5 Publications
    Corresponds to variant rs7335867 [ dbSNP | Ensembl ].
    VAR_069359

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5151MSTPA…NEMLS → ML in isoform 4. 1 PublicationVSP_055686Add
    BLAST
    Alternative sequencei53 – 531Missing in isoform 2 and isoform 3. 3 PublicationsVSP_047100
    Alternative sequencei494 – 4952PI → VR in isoform 2. 1 PublicationVSP_047101
    Alternative sequencei496 – 683188Missing in isoform 2. 1 PublicationVSP_047102Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y15758 mRNA. Translation: CAC17466.1.
    AJ429398 Genomic DNA. Translation: CAD22295.1.
    AY062261 mRNA. Translation: AAL47212.1.
    AY062262 mRNA. Translation: AAL47213.1.
    AK001611 mRNA. Translation: BAA91788.1. Different initiation.
    AK022982 mRNA. Translation: BAB14345.1.
    AK299083 mRNA. Translation: BAG61147.1.
    EF560732 mRNA. Translation: ABQ59042.1.
    AL359513 Genomic DNA. Translation: CAH71660.2.
    AL359513 Genomic DNA. Translation: CAH71661.2.
    BC010901 mRNA. Translation: AAH10901.1. Different initiation.
    BC105806 mRNA. Translation: AAI05807.1. Sequence problems.
    BC130296 mRNA. Translation: AAI30297.1.
    AF177227 mRNA. Translation: AAG33675.1. Frameshift.
    AL136848 mRNA. Translation: CAB66782.2.
    CCDSiCCDS41893.1. [Q8WWK9-1]
    CCDS9435.1. [Q8WWK9-5]
    RefSeqiNP_001091995.1. NM_001098525.2. [Q8WWK9-1]
    NP_001273615.1. NM_001286686.1.
    NP_001273616.1. NM_001286687.1. [Q8WWK9-4]
    NP_060674.3. NM_018204.4. [Q8WWK9-5]
    UniGeneiHs.444028.
    Hs.594461.

    Genome annotation databases

    EnsembliENST00000258607; ENSP00000258607; ENSG00000136108. [Q8WWK9-5]
    ENST00000378034; ENSP00000367273; ENSG00000136108. [Q8WWK9-4]
    ENST00000378037; ENSP00000367276; ENSG00000136108. [Q8WWK9-1]
    ENST00000490903; ENSP00000417830; ENSG00000136108. [Q8WWK9-6]
    GeneIDi26586.
    KEGGihsa:26586.
    UCSCiuc001vgv.2. human. [Q8WWK9-1]

    Polymorphism databases

    DMDMi74751579.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y15758 mRNA. Translation: CAC17466.1 .
    AJ429398 Genomic DNA. Translation: CAD22295.1 .
    AY062261 mRNA. Translation: AAL47212.1 .
    AY062262 mRNA. Translation: AAL47213.1 .
    AK001611 mRNA. Translation: BAA91788.1 . Different initiation.
    AK022982 mRNA. Translation: BAB14345.1 .
    AK299083 mRNA. Translation: BAG61147.1 .
    EF560732 mRNA. Translation: ABQ59042.1 .
    AL359513 Genomic DNA. Translation: CAH71660.2 .
    AL359513 Genomic DNA. Translation: CAH71661.2 .
    BC010901 mRNA. Translation: AAH10901.1 . Different initiation.
    BC105806 mRNA. Translation: AAI05807.1 . Sequence problems.
    BC130296 mRNA. Translation: AAI30297.1 .
    AF177227 mRNA. Translation: AAG33675.1 . Frameshift.
    AL136848 mRNA. Translation: CAB66782.2 .
    CCDSi CCDS41893.1. [Q8WWK9-1 ]
    CCDS9435.1. [Q8WWK9-5 ]
    RefSeqi NP_001091995.1. NM_001098525.2. [Q8WWK9-1 ]
    NP_001273615.1. NM_001286686.1.
    NP_001273616.1. NM_001286687.1. [Q8WWK9-4 ]
    NP_060674.3. NM_018204.4. [Q8WWK9-5 ]
    UniGenei Hs.444028.
    Hs.594461.

    3D structure databases

    ProteinModelPortali Q8WWK9.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117755. 3 interactions.
    IntActi Q8WWK9. 2 interactions.
    MINTi MINT-4989610.

    PTM databases

    PhosphoSitei Q8WWK9.

    Polymorphism databases

    DMDMi 74751579.

    Proteomic databases

    MaxQBi Q8WWK9.
    PaxDbi Q8WWK9.
    PRIDEi Q8WWK9.

    Protocols and materials databases

    DNASUi 26586.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000258607 ; ENSP00000258607 ; ENSG00000136108 . [Q8WWK9-5 ]
    ENST00000378034 ; ENSP00000367273 ; ENSG00000136108 . [Q8WWK9-4 ]
    ENST00000378037 ; ENSP00000367276 ; ENSG00000136108 . [Q8WWK9-1 ]
    ENST00000490903 ; ENSP00000417830 ; ENSG00000136108 . [Q8WWK9-6 ]
    GeneIDi 26586.
    KEGGi hsa:26586.
    UCSCi uc001vgv.2. human. [Q8WWK9-1 ]

    Organism-specific databases

    CTDi 26586.
    GeneCardsi GC13P053029.
    HGNCi HGNC:1990. CKAP2.
    HPAi HPA008410.
    HPA027821.
    MIMi 611569. gene.
    neXtProti NX_Q8WWK9.
    PharmGKBi PA26526.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG25272.
    HOVERGENi HBG107703.
    InParanoidi Q8WWK9.
    KOi K16769.
    OMAi KQMTTEK.
    OrthoDBi EOG7X9G6M.
    PhylomeDBi Q8WWK9.
    TreeFami TF333003.

    Miscellaneous databases

    GeneWikii CKAP2.
    GenomeRNAii 26586.
    NextBioi 48956.
    PROi Q8WWK9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8WWK9.
    Bgeei Q8WWK9.
    Genevestigatori Q8WWK9.

    Family and domain databases

    InterProi IPR029197. CKAP2_C.
    IPR026165. CKAP2_fam.
    [Graphical view ]
    PANTHERi PTHR16076. PTHR16076. 1 hit.
    Pfami PF15297. CKAP2_C. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a novel cDNA, encoding a cytoskeletal associated protein, differentially expressed in diffuse large B-cell lymphomas."
      Maouche-Chretien L., Deleu N., Badoual C., Fraissignes P., Berger R., Gaulard P., Romeo P.H., Leroy-Viard K.
      Oncogene 17:1245-1251(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT VAL-323.
      Tissue: T-cellImported.
    2. "Evolutionarily-conserved gene CKAP2,located in region 13q14.3 of the human genome, is frequently rearranged in various tumors."
      Udina I.G., Baranova A.V., Kompaniytsev A.A., Sulimova G.E.
      Genetika 37:120-123(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    3. "Up-regulation of cytoskeletal-associated protein 2 in primary human gastric adenocarcinomas."
      Bae C.-D., Sung Y.-S., Jeon S.-M., Suh Y., Yang H.-K., Kim Y.-I., Park K.-H., Choi J., Ahn G., Park J.
      J. Cancer Res. Clin. Oncol. 129:621-630(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBCELLULAR LOCATION, INDUCTION.
      Tissue: Cervix carcinomaImported.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT VAL-323.
      Tissue: TeratocarcinomaImported.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    6. "The DNA sequence and analysis of human chromosome 13."
      Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
      Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT VAL-323.
      Tissue: Bone marrowImported, Cerebellum and TestisImported.
    8. "Serological detection of cutaneous T-cell lymphoma-associated antigens."
      Eichmueller S., Usener D., Dummer R., Stein A., Thiel D., Schadendorf D.
      Proc. Natl. Acad. Sci. U.S.A. 98:629-634(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 38-683 (ISOFORM 1), VARIANTS LYS-236 AND VAL-323.
      Tissue: TestisImported.
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 135-683 (ISOFORM 1), VARIANT VAL-323.
      Tissue: TestisImported.
    10. "CKAP2 is a spindle-associated protein degraded by APC/C-Cdh1 during mitotic exit."
      Seki A., Fang G.
      J. Biol. Chem. 282:15103-15113(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE.
    11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-579; THR-582; SER-595; THR-596; THR-597; TYR-599 AND SER-602, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-597 AND SER-602, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-534; SER-595; THR-597 AND SER-602, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCKAP2_HUMAN
    AccessioniPrimary (citable) accession number: Q8WWK9
    Secondary accession number(s): A2BDE0
    , A5YM58, B4DR35, E9PD90, Q3KRA5, Q5VXB4, Q8IWV5, Q8IWV6, Q96FH9, Q9H012, Q9H0D0, Q9H988, Q9HC49, Q9NVG4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 11, 2006
    Last sequence update: March 1, 2002
    Last modified: October 1, 2014
    This is version 102 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 13
      Human chromosome 13: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3