Q8WW22 (DNJA4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 16, 2012.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DnaJ homolog subfamily A member 4 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 397 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Membrane; Lipid-anchor Potential. |
| Sequence similarities | Contains 1 CR-type zinc finger. Contains 1 J domain. |
| Sequence caution | The sequence AAH21720.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | Chaperone |
| PTM | Lipoprotein Methylation Prenylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | protein folding Inferred from electronic annotation. Source: InterPro response to heatInferred from electronic annotation. Source: InterPro |
| Cellular component | membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP binding Inferred from electronic annotation. Source: InterPro heat shock protein bindingInferred from electronic annotation. Source: InterPro metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW unfolded protein bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WW22-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WW22-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MARGGSQSWSSGESDGQPKEQTPEKPRHKM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 394 | 394 | DnaJ homolog subfamily A member 4 | PRO_0000071014 | |||||
| Propeptide | 395 – 397 | 3 | Removed in mature form By similarity | PRO_0000396760 | |||||
Regions | |||||||||
| Domain | 4 – 70 | 67 | J | ||||||
| Repeat | 135 – 142 | 8 | CXXCXGXG motif | ||||||
| Repeat | 151 – 158 | 8 | CXXCXGXG motif | ||||||
| Repeat | 178 – 185 | 8 | CXXCXGXG motif | ||||||
| Repeat | 194 – 201 | 8 | CXXCXGXG motif | ||||||
| Zinc finger | 122 – 206 | 85 | CR-type | ||||||
| Compositional bias | 75 – 96 | 22 | Gly-rich | ||||||
Sites | |||||||||
| Metal binding | 135 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 138 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 151 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 154 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 178 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 181 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 194 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 197 | 1 | Zinc 1 By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 394 | 1 | Cysteine methyl ester By similarity | ||||||
| Lipidation | 394 | 1 | S-farnesyl cysteine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MARGGSQSWSSGESDGQPKE QTPEKPRHKM in isoform 2. | VSP_038965 | |||||
Experimental info | |||||||||
| Sequence conflict | 33 | 1 | Y → C in BAC05229. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK096616 mRNA. Translation: BAC04828.1. AK098079 mRNA. Translation: BAC05229.1. BX648710 mRNA. Translation: CAH10558.1. AC092755 Genomic DNA. No translation available. CH471136 Genomic DNA. Translation: EAW99177.1. BC021720 mRNA. Translation: AAH21720.1. Different initiation. |
| IPI | IPI00465105. IPI00853174. |
| RefSeq | NP_001123654.1. NM_001130182.1. NP_001123655.1. NM_001130183.1. NP_061072.3. NM_018602.3. |
| UniGene | Hs.513053. |
3D structure databases | |
| ProteinModelPortal | Q8WW22. |
| SMR | Q8WW22. Positions 3-68, 102-370. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8WW22. 2 interactions. |
| STRING | Q8WW22. |
PTM databases | |
| PhosphoSite | Q8WW22. |
Polymorphism databases | |
| DMDM | 27805462. |
Proteomic databases | |
| PRIDE | Q8WW22. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000343789; ENSP00000339581; ENSG00000140403. ENST00000394852; ENSP00000378321; ENSG00000140403. ENST00000394855; ENSP00000378324; ENSG00000140403. |
| GeneID | 55466. |
| KEGG | hsa:55466. |
| UCSC | uc002bdi.3. human. uc002bdj.2. human. |
Organism-specific databases | |
| CTD | 55466. |
| GeneCards | GC15P078556. |
| HGNC | HGNC:14885. DNAJA4. |
| HPA | CAB004646. |
| neXtProt | NX_Q8WW22. |
| PharmGKB | PA27411. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0484. |
| GeneTree | ENSGT00490000043321. |
| HOGENOM | HOG000226718. |
| HOVERGEN | HBG066727. |
| InParanoid | Q8WW22. |
| KO | K09505. |
| OMA | VIFPEKH. |
| OrthoDB | EOG4RJG1R. |
| PhylomeDB | Q8WW22. |
Gene expression databases | |
| ArrayExpress | Q6AW87. |
| Bgee | Q8WW22. |
| CleanEx | HS_DNAJA4. |
| Genevestigator | Q8WW22. |
| GermOnline | ENSG00000140403. Homo sapiens. |
Family and domain databases | |
| Gene3D | G3DSA:1.10.287.110. DnaJ_N. 1 hit. G3DSA:2.10.230.10. HSP_DnaJ_cys-rich. 1 hit. |
| InterPro | IPR012724. DnaJ. IPR002939. DnaJ_C. IPR001623. DnaJ_N. IPR018253. Heat_shock_DnaJ_CS. IPR008971. HSP40/DnaJ_pept-bd. IPR003095. Hsp_DnaJ. IPR001305. HSP_DnaJ_Cys-rich_dom. [Graphical view] |
| Pfam | PF00226. DnaJ. 1 hit. PF01556. DnaJ_C. 1 hit. PF00684. DnaJ_CXXCXGXG. 1 hit. [Graphical view] |
| PRINTS | PR00625. JDOMAIN. |
| SMART | SM00271. DnaJ. 1 hit. [Graphical view] |
| SUPFAM | SSF46565. DnaJ_N. 1 hit. SSF49493. HSP40_DnaJ_pep. 2 hits. SSF57938. HSP_DnaJ_cys-rich. 1 hit. |
| PROSITE | PS00636. DNAJ_1. 1 hit. PS50076. DNAJ_2. 1 hit. PS51188. ZF_CR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 59854. |
Entry information
| Entry name | DNJA4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WW22 Secondary accession number(s): Q6AW87, Q8N7P2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with