Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WW22

- DNJA4_HUMAN

UniProt

Q8WW22 - DNJA4_HUMAN

Protein

DnaJ homolog subfamily A member 4

Gene

DNAJA4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 1 (01 Mar 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi135 – 1351Zinc 1By similarity
    Metal bindingi138 – 1381Zinc 1By similarity
    Metal bindingi151 – 1511Zinc 2By similarity
    Metal bindingi154 – 1541Zinc 2By similarity
    Metal bindingi178 – 1781Zinc 2By similarity
    Metal bindingi181 – 1811Zinc 2By similarity
    Metal bindingi194 – 1941Zinc 1By similarity
    Metal bindingi197 – 1971Zinc 1By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri122 – 20685CR-typeAdd
    BLAST

    GO - Molecular functioni

    1. ATP binding Source: InterPro
    2. chaperone binding Source: UniProt
    3. metal ion binding Source: UniProtKB-KW
    4. unfolded protein binding Source: UniProt

    GO - Biological processi

    1. negative regulation of inclusion body assembly Source: UniProt
    2. protein refolding Source: UniProt
    3. response to heat Source: InterPro

    Keywords - Molecular functioni

    Chaperone

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    DnaJ homolog subfamily A member 4
    Gene namesi
    Name:DNAJA4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:14885. DNAJA4.

    Subcellular locationi

    Membrane Curated; Lipid-anchor Curated

    GO - Cellular componenti

    1. cytosol Source: UniProt
    2. membrane Source: UniProt

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27411.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 394394DnaJ homolog subfamily A member 4PRO_0000071014Add
    BLAST
    Propeptidei395 – 3973Removed in mature formBy similarityPRO_0000396760

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei394 – 3941Cysteine methyl esterBy similarity
    Lipidationi394 – 3941S-farnesyl cysteineBy similarity

    Keywords - PTMi

    Lipoprotein, Methylation, Prenylation

    Proteomic databases

    MaxQBiQ8WW22.
    PaxDbiQ8WW22.
    PRIDEiQ8WW22.

    PTM databases

    PhosphoSiteiQ8WW22.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8WW22.
    BgeeiQ8WW22.
    CleanExiHS_DNAJA4.
    GenevestigatoriQ8WW22.

    Organism-specific databases

    HPAiCAB004646.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DNAJA2O608842EBI-2555157,EBI-352957
    ENDOGQ142492EBI-2555157,EBI-9369928

    Protein-protein interaction databases

    BioGridi120675. 5 interactions.
    IntActiQ8WW22. 16 interactions.
    STRINGi9606.ENSP00000378324.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8WW22.
    SMRiQ8WW22. Positions 1-331.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini4 – 7067JAdd
    BLAST
    Repeati135 – 1428CXXCXGXG motif
    Repeati151 – 1588CXXCXGXG motif
    Repeati178 – 1858CXXCXGXG motif
    Repeati194 – 2018CXXCXGXG motif

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi75 – 9622Gly-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 CR-type zinc finger.Curated
    Contains 1 J domain.Curated

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri122 – 20685CR-typeAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG0484.
    HOGENOMiHOG000226718.
    HOVERGENiHBG066727.
    InParanoidiQ8WW22.
    KOiK09505.
    OMAiPNEQNWR.
    OrthoDBiEOG7XM2XK.
    PhylomeDBiQ8WW22.
    TreeFamiTF105141.

    Family and domain databases

    Gene3Di1.10.287.110. 1 hit.
    2.10.230.10. 1 hit.
    HAMAPiMF_01152. DnaJ.
    InterProiIPR012724. DnaJ.
    IPR002939. DnaJ_C.
    IPR001623. DnaJ_domain.
    IPR018253. DnaJ_domain_CS.
    IPR008971. HSP40/DnaJ_pept-bd.
    IPR001305. HSP_DnaJ_Cys-rich_dom.
    [Graphical view]
    PfamiPF01556. CTDII. 1 hit.
    PF00226. DnaJ. 1 hit.
    PF00684. DnaJ_CXXCXGXG. 1 hit.
    [Graphical view]
    PRINTSiPR00625. JDOMAIN.
    SMARTiSM00271. DnaJ. 1 hit.
    [Graphical view]
    SUPFAMiSSF46565. SSF46565. 1 hit.
    SSF49493. SSF49493. 3 hits.
    SSF57938. SSF57938. 1 hit.
    PROSITEiPS00636. DNAJ_1. 1 hit.
    PS50076. DNAJ_2. 1 hit.
    PS51188. ZF_CR. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8WW22-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVKETQYYDI LGVKPSASPE EIKKAYRKLA LKYHPDKNPD EGEKFKLISQ    50
    AYEVLSDPKK RDVYDQGGEQ AIKEGGSGSP SFSSPMDIFD MFFGGGGRMA 100
    RERRGKNVVH QLSVTLEDLY NGVTKKLALQ KNVICEKCEG VGGKKGSVEK 150
    CPLCKGRGMQ IHIQQIGPGM VQQIQTVCIE CKGQGERINP KDRCESCSGA 200
    KVIREKKIIE VHVEKGMKDG QKILFHGEGD QEPELEPGDV IIVLDQKDHS 250
    VFQRRGHDLI MKMKIQLSEA LCGFKKTIKT LDNRILVITS KAGEVIKHGD 300
    LRCVRDEGMP IYKAPLEKGI LIIQFLVIFP EKHWLSLEKL PQLEALLPPR 350
    QKVRITDDMD QVELKEFCPN EQNWRQHREA YEEDEDGPQA GVQCQTA 397
    Length:397
    Mass (Da):44,798
    Last modified:March 1, 2002 - v1
    Checksum:i60D6AAD12C9B2529
    GO
    Isoform 2 (identifier: Q8WW22-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MARGGSQSWSSGESDGQPKEQTPEKPRHKM

    Show »
    Length:426
    Mass (Da):47,963
    Checksum:i820C0BE7F54EB221
    GO
    Isoform 3 (identifier: Q8WW22-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-44: MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEK → MWESLTLDSGQISALTR

    Note: No experimental confirmation available.Curated

    Show »
    Length:370
    Mass (Da):41,597
    Checksum:i3FCEABA5F96D48A2
    GO

    Sequence cautioni

    The sequence AAH21720.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAH31044.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti33 – 331Y → C in BAC05229. (PubMed:14702039)Curated
    Isoform 3 (identifier: Q8WW22-3)
    Sequence conflicti1 – 11M → T in AAH31044. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti226 – 2261H → R.1 Publication
    Corresponds to variant rs17852881 [ dbSNP | Ensembl ].
    VAR_069064

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4444MVKET…DEGEK → MWESLTLDSGQISALTR in isoform 3. 1 PublicationVSP_045696Add
    BLAST
    Alternative sequencei1 – 11M → MARGGSQSWSSGESDGQPKE QTPEKPRHKM in isoform 2. 2 PublicationsVSP_038965

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK096616 mRNA. Translation: BAC04828.1.
    AK098079 mRNA. Translation: BAC05229.1.
    BX648710 mRNA. Translation: CAH10558.1.
    AC092755 Genomic DNA. No translation available.
    CH471136 Genomic DNA. Translation: EAW99177.1.
    BC021720 mRNA. Translation: AAH21720.1. Different initiation.
    BC031044 mRNA. Translation: AAH31044.2. Different initiation.
    CCDSiCCDS10299.2. [Q8WW22-2]
    CCDS45316.1. [Q8WW22-1]
    CCDS45317.1. [Q8WW22-3]
    RefSeqiNP_001123654.1. NM_001130182.1. [Q8WW22-1]
    NP_001123655.1. NM_001130183.1. [Q8WW22-3]
    NP_061072.3. NM_018602.3. [Q8WW22-2]
    XP_005254592.1. XM_005254535.1. [Q8WW22-1]
    XP_006720664.1. XM_006720601.1. [Q8WW22-1]
    UniGeneiHs.513053.

    Genome annotation databases

    EnsembliENST00000343789; ENSP00000339581; ENSG00000140403. [Q8WW22-1]
    ENST00000394852; ENSP00000378321; ENSG00000140403. [Q8WW22-1]
    ENST00000394855; ENSP00000378324; ENSG00000140403. [Q8WW22-2]
    ENST00000446172; ENSP00000413499; ENSG00000140403. [Q8WW22-3]
    GeneIDi55466.
    KEGGihsa:55466.
    UCSCiuc002bdi.3. human. [Q8WW22-2]
    uc002bdj.2. human. [Q8WW22-1]

    Polymorphism databases

    DMDMi27805462.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK096616 mRNA. Translation: BAC04828.1 .
    AK098079 mRNA. Translation: BAC05229.1 .
    BX648710 mRNA. Translation: CAH10558.1 .
    AC092755 Genomic DNA. No translation available.
    CH471136 Genomic DNA. Translation: EAW99177.1 .
    BC021720 mRNA. Translation: AAH21720.1 . Different initiation.
    BC031044 mRNA. Translation: AAH31044.2 . Different initiation.
    CCDSi CCDS10299.2. [Q8WW22-2 ]
    CCDS45316.1. [Q8WW22-1 ]
    CCDS45317.1. [Q8WW22-3 ]
    RefSeqi NP_001123654.1. NM_001130182.1. [Q8WW22-1 ]
    NP_001123655.1. NM_001130183.1. [Q8WW22-3 ]
    NP_061072.3. NM_018602.3. [Q8WW22-2 ]
    XP_005254592.1. XM_005254535.1. [Q8WW22-1 ]
    XP_006720664.1. XM_006720601.1. [Q8WW22-1 ]
    UniGenei Hs.513053.

    3D structure databases

    ProteinModelPortali Q8WW22.
    SMRi Q8WW22. Positions 1-331.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120675. 5 interactions.
    IntActi Q8WW22. 16 interactions.
    STRINGi 9606.ENSP00000378324.

    PTM databases

    PhosphoSitei Q8WW22.

    Polymorphism databases

    DMDMi 27805462.

    Proteomic databases

    MaxQBi Q8WW22.
    PaxDbi Q8WW22.
    PRIDEi Q8WW22.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000343789 ; ENSP00000339581 ; ENSG00000140403 . [Q8WW22-1 ]
    ENST00000394852 ; ENSP00000378321 ; ENSG00000140403 . [Q8WW22-1 ]
    ENST00000394855 ; ENSP00000378324 ; ENSG00000140403 . [Q8WW22-2 ]
    ENST00000446172 ; ENSP00000413499 ; ENSG00000140403 . [Q8WW22-3 ]
    GeneIDi 55466.
    KEGGi hsa:55466.
    UCSCi uc002bdi.3. human. [Q8WW22-2 ]
    uc002bdj.2. human. [Q8WW22-1 ]

    Organism-specific databases

    CTDi 55466.
    GeneCardsi GC15P078556.
    HGNCi HGNC:14885. DNAJA4.
    HPAi CAB004646.
    neXtProti NX_Q8WW22.
    PharmGKBi PA27411.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0484.
    HOGENOMi HOG000226718.
    HOVERGENi HBG066727.
    InParanoidi Q8WW22.
    KOi K09505.
    OMAi PNEQNWR.
    OrthoDBi EOG7XM2XK.
    PhylomeDBi Q8WW22.
    TreeFami TF105141.

    Miscellaneous databases

    ChiTaRSi DNAJA4. human.
    GenomeRNAii 55466.
    NextBioi 59854.
    PROi Q8WW22.

    Gene expression databases

    ArrayExpressi Q8WW22.
    Bgeei Q8WW22.
    CleanExi HS_DNAJA4.
    Genevestigatori Q8WW22.

    Family and domain databases

    Gene3Di 1.10.287.110. 1 hit.
    2.10.230.10. 1 hit.
    HAMAPi MF_01152. DnaJ.
    InterProi IPR012724. DnaJ.
    IPR002939. DnaJ_C.
    IPR001623. DnaJ_domain.
    IPR018253. DnaJ_domain_CS.
    IPR008971. HSP40/DnaJ_pept-bd.
    IPR001305. HSP_DnaJ_Cys-rich_dom.
    [Graphical view ]
    Pfami PF01556. CTDII. 1 hit.
    PF00226. DnaJ. 1 hit.
    PF00684. DnaJ_CXXCXGXG. 1 hit.
    [Graphical view ]
    PRINTSi PR00625. JDOMAIN.
    SMARTi SM00271. DnaJ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46565. SSF46565. 1 hit.
    SSF49493. SSF49493. 3 hits.
    SSF57938. SSF57938. 1 hit.
    PROSITEi PS00636. DNAJ_1. 1 hit.
    PS50076. DNAJ_2. 1 hit.
    PS51188. ZF_CR. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Trachea.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Endometrial tumor.
    3. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT ARG-226.
      Tissue: Brain and Testis.
    6. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiDNJA4_HUMAN
    AccessioniPrimary (citable) accession number: Q8WW22
    Secondary accession number(s): E9PDM9
    , Q6AW87, Q8N5Z4, Q8N7P2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 17, 2003
    Last sequence update: March 1, 2002
    Last modified: October 1, 2014
    This is version 111 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3