Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8WW22 (DNJA4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 110. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
DnaJ homolog subfamily A member 4
Gene names
Name:DNAJA4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length397 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Membrane; Lipid-anchor Potential HAMAP-Rule MF_01152.

Sequence similarities

Contains 1 CR-type zinc finger.

Contains 1 J domain.

Sequence caution

The sequence AAH21720.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAH31044.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8WW22-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8WW22-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARGGSQSWSSGESDGQPKEQTPEKPRHKM
Isoform 3 (identifier: Q8WW22-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEK → MWESLTLDSGQISALTR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 394394DnaJ homolog subfamily A member 4 HAMAP-Rule MF_01152
PRO_0000071014
Propeptide395 – 3973Removed in mature form By similarity
PRO_0000396760

Regions

Domain4 – 7067J
Repeat135 – 1428CXXCXGXG motif HAMAP-Rule MF_01152
Repeat151 – 1588CXXCXGXG motif HAMAP-Rule MF_01152
Repeat178 – 1858CXXCXGXG motif HAMAP-Rule MF_01152
Repeat194 – 2018CXXCXGXG motif HAMAP-Rule MF_01152
Zinc finger122 – 20685CR-type HAMAP-Rule MF_01152
Compositional bias75 – 9622Gly-rich HAMAP-Rule MF_01152

Sites

Metal binding1351Zinc 1 By similarity
Metal binding1381Zinc 1 By similarity
Metal binding1511Zinc 2 By similarity
Metal binding1541Zinc 2 By similarity
Metal binding1781Zinc 2 By similarity
Metal binding1811Zinc 2 By similarity
Metal binding1941Zinc 1 By similarity
Metal binding1971Zinc 1 By similarity

Amino acid modifications

Modified residue3941Cysteine methyl ester By similarity
Lipidation3941S-farnesyl cysteine By similarity

Natural variations

Alternative sequence1 – 4444MVKET…DEGEK → MWESLTLDSGQISALTR in isoform 3.
VSP_045696
Alternative sequence11M → MARGGSQSWSSGESDGQPKE QTPEKPRHKM in isoform 2.
VSP_038965
Natural variant2261H → R. Ref.5
Corresponds to variant rs17852881 [ dbSNP | Ensembl ].
VAR_069064

Experimental info

Sequence conflict331Y → C in BAC05229. Ref.1
Isoform 3:
Sequence conflict11M → T in AAH31044. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2002. Version 1.
Checksum: 60D6AAD12C9B2529

FASTA39744,798
        10         20         30         40         50         60 
MVKETQYYDI LGVKPSASPE EIKKAYRKLA LKYHPDKNPD EGEKFKLISQ AYEVLSDPKK 

        70         80         90        100        110        120 
RDVYDQGGEQ AIKEGGSGSP SFSSPMDIFD MFFGGGGRMA RERRGKNVVH QLSVTLEDLY 

       130        140        150        160        170        180 
NGVTKKLALQ KNVICEKCEG VGGKKGSVEK CPLCKGRGMQ IHIQQIGPGM VQQIQTVCIE 

       190        200        210        220        230        240 
CKGQGERINP KDRCESCSGA KVIREKKIIE VHVEKGMKDG QKILFHGEGD QEPELEPGDV 

       250        260        270        280        290        300 
IIVLDQKDHS VFQRRGHDLI MKMKIQLSEA LCGFKKTIKT LDNRILVITS KAGEVIKHGD 

       310        320        330        340        350        360 
LRCVRDEGMP IYKAPLEKGI LIIQFLVIFP EKHWLSLEKL PQLEALLPPR QKVRITDDMD 

       370        380        390 
QVELKEFCPN EQNWRQHREA YEEDEDGPQA GVQCQTA 

« Hide

Isoform 2 [UniParc].

Checksum: 820C0BE7F54EB221
Show »

FASTA42647,963
Isoform 3 [UniParc].

Checksum: 3FCEABA5F96D48A2
Show »

FASTA37041,597

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Trachea.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Endometrial tumor.
[3]"Analysis of the DNA sequence and duplication history of human chromosome 15."
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. expand/collapse author list , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT ARG-226.
Tissue: Brain and Testis.
[6]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK096616 mRNA. Translation: BAC04828.1.
AK098079 mRNA. Translation: BAC05229.1.
BX648710 mRNA. Translation: CAH10558.1.
AC092755 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99177.1.
BC021720 mRNA. Translation: AAH21720.1. Different initiation.
BC031044 mRNA. Translation: AAH31044.2. Different initiation.
CCDSCCDS10299.2. [Q8WW22-2]
CCDS45316.1. [Q8WW22-1]
CCDS45317.1. [Q8WW22-3]
RefSeqNP_001123654.1. NM_001130182.1. [Q8WW22-1]
NP_001123655.1. NM_001130183.1. [Q8WW22-3]
NP_061072.3. NM_018602.3. [Q8WW22-2]
XP_005254592.1. XM_005254535.1. [Q8WW22-1]
XP_006720664.1. XM_006720601.1. [Q8WW22-1]
UniGeneHs.513053.

3D structure databases

ProteinModelPortalQ8WW22.
SMRQ8WW22. Positions 1-331.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120675. 5 interactions.
IntActQ8WW22. 4 interactions.
STRING9606.ENSP00000378324.

PTM databases

PhosphoSiteQ8WW22.

Polymorphism databases

DMDM27805462.

Proteomic databases

MaxQBQ8WW22.
PaxDbQ8WW22.
PRIDEQ8WW22.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000343789; ENSP00000339581; ENSG00000140403. [Q8WW22-1]
ENST00000394852; ENSP00000378321; ENSG00000140403. [Q8WW22-1]
ENST00000394855; ENSP00000378324; ENSG00000140403. [Q8WW22-2]
ENST00000446172; ENSP00000413499; ENSG00000140403. [Q8WW22-3]
GeneID55466.
KEGGhsa:55466.
UCSCuc002bdi.3. human. [Q8WW22-2]
uc002bdj.2. human. [Q8WW22-1]

Organism-specific databases

CTD55466.
GeneCardsGC15P078556.
HGNCHGNC:14885. DNAJA4.
HPACAB004646.
neXtProtNX_Q8WW22.
PharmGKBPA27411.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0484.
HOGENOMHOG000226718.
HOVERGENHBG066727.
InParanoidQ8WW22.
KOK09505.
OMAPNEQNWR.
OrthoDBEOG7XM2XK.
PhylomeDBQ8WW22.
TreeFamTF105141.

Gene expression databases

ArrayExpressQ8WW22.
BgeeQ8WW22.
CleanExHS_DNAJA4.
GenevestigatorQ8WW22.

Family and domain databases

Gene3D1.10.287.110. 1 hit.
2.10.230.10. 1 hit.
HAMAPMF_01152. DnaJ.
InterProIPR012724. DnaJ.
IPR002939. DnaJ_C.
IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
IPR008971. HSP40/DnaJ_pept-bd.
IPR001305. HSP_DnaJ_Cys-rich_dom.
[Graphical view]
PfamPF01556. CTDII. 1 hit.
PF00226. DnaJ. 1 hit.
PF00684. DnaJ_CXXCXGXG. 1 hit.
[Graphical view]
PRINTSPR00625. JDOMAIN.
SMARTSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMSSF46565. SSF46565. 1 hit.
SSF49493. SSF49493. 3 hits.
SSF57938. SSF57938. 1 hit.
PROSITEPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
PS51188. ZF_CR. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSDNAJA4. human.
GenomeRNAi55466.
NextBio59854.
PROQ8WW22.

Entry information

Entry nameDNJA4_HUMAN
AccessionPrimary (citable) accession number: Q8WW22
Secondary accession number(s): E9PDM9 expand/collapse secondary AC list , Q6AW87, Q8N5Z4, Q8N7P2
Entry history
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: March 1, 2002
Last modified: July 9, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 15

Human chromosome 15: entries, gene names and cross-references to MIM