Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily A member 4

Gene

DNAJA4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi135Zinc 1By similarity1
Metal bindingi138Zinc 1By similarity1
Metal bindingi151Zinc 2By similarity1
Metal bindingi154Zinc 2By similarity1
Metal bindingi178Zinc 2By similarity1
Metal bindingi181Zinc 2By similarity1
Metal bindingi194Zinc 1By similarity1
Metal bindingi197Zinc 1By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri122 – 206CR-typeAdd BLAST85

GO - Molecular functioni

  • ATP binding Source: InterPro
  • chaperone binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • unfolded protein binding Source: UniProtKB

GO - Biological processi

  • negative regulation of inclusion body assembly Source: UniProtKB
  • protein refolding Source: UniProtKB
  • response to heat Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140403-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily A member 4
Gene namesi
Name:DNAJA4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:14885. DNAJA4.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000140403.
PharmGKBiPA27411.

Polymorphism and mutation databases

BioMutaiDNAJA4.
DMDMi27805462.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000710141 – 394DnaJ homolog subfamily A member 4Add BLAST394
PropeptideiPRO_0000396760395 – 397Removed in mature formBy similarity3

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei18PhosphoserineCombined sources1
Modified residuei394Cysteine methyl esterBy similarity1
Lipidationi394S-farnesyl cysteineBy similarity1

Keywords - PTMi

Lipoprotein, Methylation, Phosphoprotein, Prenylation

Proteomic databases

EPDiQ8WW22.
MaxQBiQ8WW22.
PaxDbiQ8WW22.
PeptideAtlasiQ8WW22.
PRIDEiQ8WW22.

PTM databases

iPTMnetiQ8WW22.
PhosphoSitePlusiQ8WW22.

Expressioni

Gene expression databases

BgeeiENSG00000140403.
CleanExiHS_DNAJA4.
ExpressionAtlasiQ8WW22. baseline and differential.
GenevisibleiQ8WW22. HS.

Organism-specific databases

HPAiCAB004646.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
BANPQ8N9N53EBI-10277181,EBI-744695
DNAJA2O608842EBI-2555157,EBI-352957
ENDOGQ142492EBI-2555157,EBI-9369928

GO - Molecular functioni

  • chaperone binding Source: UniProtKB
  • unfolded protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi120675. 46 interactors.
IntActiQ8WW22. 23 interactors.
STRINGi9606.ENSP00000378324.

Structurei

3D structure databases

ProteinModelPortaliQ8WW22.
SMRiQ8WW22.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 70JAdd BLAST67
Repeati135 – 142CXXCXGXG motif8
Repeati151 – 158CXXCXGXG motif8
Repeati178 – 185CXXCXGXG motif8
Repeati194 – 201CXXCXGXG motif8

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi75 – 96Gly-richAdd BLAST22

Sequence similaritiesi

Contains 1 CR-type zinc finger.Curated
Contains 1 J domain.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri122 – 206CR-typeAdd BLAST85

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0712. Eukaryota.
COG0484. LUCA.
GeneTreeiENSGT00860000133716.
HOGENOMiHOG000226718.
HOVERGENiHBG066727.
InParanoidiQ8WW22.
KOiK09505.
OMAiQNWSSGE.
OrthoDBiEOG091G0CAC.
PhylomeDBiQ8WW22.
TreeFamiTF105141.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
2.10.230.10. 1 hit.
HAMAPiMF_01152. DnaJ. 1 hit.
InterProiIPR012724. DnaJ.
IPR002939. DnaJ_C.
IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
IPR008971. HSP40/DnaJ_pept-bd.
IPR001305. HSP_DnaJ_Cys-rich_dom.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
PF01556. DnaJ_C. 1 hit.
PF00684. DnaJ_CXXCXGXG. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
SSF49493. SSF49493. 3 hits.
SSF57938. SSF57938. 1 hit.
PROSITEiPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
PS51188. ZF_CR. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WW22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKETQYYDI LGVKPSASPE EIKKAYRKLA LKYHPDKNPD EGEKFKLISQ
60 70 80 90 100
AYEVLSDPKK RDVYDQGGEQ AIKEGGSGSP SFSSPMDIFD MFFGGGGRMA
110 120 130 140 150
RERRGKNVVH QLSVTLEDLY NGVTKKLALQ KNVICEKCEG VGGKKGSVEK
160 170 180 190 200
CPLCKGRGMQ IHIQQIGPGM VQQIQTVCIE CKGQGERINP KDRCESCSGA
210 220 230 240 250
KVIREKKIIE VHVEKGMKDG QKILFHGEGD QEPELEPGDV IIVLDQKDHS
260 270 280 290 300
VFQRRGHDLI MKMKIQLSEA LCGFKKTIKT LDNRILVITS KAGEVIKHGD
310 320 330 340 350
LRCVRDEGMP IYKAPLEKGI LIIQFLVIFP EKHWLSLEKL PQLEALLPPR
360 370 380 390
QKVRITDDMD QVELKEFCPN EQNWRQHREA YEEDEDGPQA GVQCQTA
Length:397
Mass (Da):44,798
Last modified:March 1, 2002 - v1
Checksum:i60D6AAD12C9B2529
GO
Isoform 2 (identifier: Q8WW22-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARGGSQSWSSGESDGQPKEQTPEKPRHKM

Show »
Length:426
Mass (Da):47,963
Checksum:i820C0BE7F54EB221
GO
Isoform 3 (identifier: Q8WW22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEK → MWESLTLDSGQISALTR

Note: No experimental confirmation available.Curated
Show »
Length:370
Mass (Da):41,597
Checksum:i3FCEABA5F96D48A2
GO

Sequence cautioni

The sequence AAH21720 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH31044 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti33Y → C in BAC05229 (PubMed:14702039).Curated1
Isoform 3 (identifier: Q8WW22-3)
Sequence conflicti1M → T in AAH31044 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069064226H → R.1 PublicationCorresponds to variant rs17852881dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0456961 – 44MVKET…DEGEK → MWESLTLDSGQISALTR in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0389651M → MARGGSQSWSSGESDGQPKE QTPEKPRHKM in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096616 mRNA. Translation: BAC04828.1.
AK098079 mRNA. Translation: BAC05229.1.
BX648710 mRNA. Translation: CAH10558.1.
AC092755 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99177.1.
BC021720 mRNA. Translation: AAH21720.1. Different initiation.
BC031044 mRNA. Translation: AAH31044.2. Different initiation.
CCDSiCCDS10299.2. [Q8WW22-2]
CCDS45316.1. [Q8WW22-1]
CCDS45317.1. [Q8WW22-3]
RefSeqiNP_001123654.1. NM_001130182.1. [Q8WW22-1]
NP_001123655.1. NM_001130183.1. [Q8WW22-3]
NP_061072.3. NM_018602.3. [Q8WW22-2]
XP_005254592.1. XM_005254535.3. [Q8WW22-1]
XP_006720664.1. XM_006720601.1. [Q8WW22-1]
UniGeneiHs.513053.

Genome annotation databases

EnsembliENST00000343789; ENSP00000339581; ENSG00000140403. [Q8WW22-1]
ENST00000394852; ENSP00000378321; ENSG00000140403. [Q8WW22-1]
ENST00000394855; ENSP00000378324; ENSG00000140403. [Q8WW22-2]
ENST00000446172; ENSP00000413499; ENSG00000140403. [Q8WW22-3]
GeneIDi55466.
KEGGihsa:55466.
UCSCiuc002bdi.4. human. [Q8WW22-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096616 mRNA. Translation: BAC04828.1.
AK098079 mRNA. Translation: BAC05229.1.
BX648710 mRNA. Translation: CAH10558.1.
AC092755 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99177.1.
BC021720 mRNA. Translation: AAH21720.1. Different initiation.
BC031044 mRNA. Translation: AAH31044.2. Different initiation.
CCDSiCCDS10299.2. [Q8WW22-2]
CCDS45316.1. [Q8WW22-1]
CCDS45317.1. [Q8WW22-3]
RefSeqiNP_001123654.1. NM_001130182.1. [Q8WW22-1]
NP_001123655.1. NM_001130183.1. [Q8WW22-3]
NP_061072.3. NM_018602.3. [Q8WW22-2]
XP_005254592.1. XM_005254535.3. [Q8WW22-1]
XP_006720664.1. XM_006720601.1. [Q8WW22-1]
UniGeneiHs.513053.

3D structure databases

ProteinModelPortaliQ8WW22.
SMRiQ8WW22.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120675. 46 interactors.
IntActiQ8WW22. 23 interactors.
STRINGi9606.ENSP00000378324.

PTM databases

iPTMnetiQ8WW22.
PhosphoSitePlusiQ8WW22.

Polymorphism and mutation databases

BioMutaiDNAJA4.
DMDMi27805462.

Proteomic databases

EPDiQ8WW22.
MaxQBiQ8WW22.
PaxDbiQ8WW22.
PeptideAtlasiQ8WW22.
PRIDEiQ8WW22.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343789; ENSP00000339581; ENSG00000140403. [Q8WW22-1]
ENST00000394852; ENSP00000378321; ENSG00000140403. [Q8WW22-1]
ENST00000394855; ENSP00000378324; ENSG00000140403. [Q8WW22-2]
ENST00000446172; ENSP00000413499; ENSG00000140403. [Q8WW22-3]
GeneIDi55466.
KEGGihsa:55466.
UCSCiuc002bdi.4. human. [Q8WW22-1]

Organism-specific databases

CTDi55466.
GeneCardsiDNAJA4.
HGNCiHGNC:14885. DNAJA4.
HPAiCAB004646.
neXtProtiNX_Q8WW22.
OpenTargetsiENSG00000140403.
PharmGKBiPA27411.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0712. Eukaryota.
COG0484. LUCA.
GeneTreeiENSGT00860000133716.
HOGENOMiHOG000226718.
HOVERGENiHBG066727.
InParanoidiQ8WW22.
KOiK09505.
OMAiQNWSSGE.
OrthoDBiEOG091G0CAC.
PhylomeDBiQ8WW22.
TreeFamiTF105141.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000140403-MONOMER.

Miscellaneous databases

ChiTaRSiDNAJA4. human.
GenomeRNAii55466.
PROiQ8WW22.

Gene expression databases

BgeeiENSG00000140403.
CleanExiHS_DNAJA4.
ExpressionAtlasiQ8WW22. baseline and differential.
GenevisibleiQ8WW22. HS.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
2.10.230.10. 1 hit.
HAMAPiMF_01152. DnaJ. 1 hit.
InterProiIPR012724. DnaJ.
IPR002939. DnaJ_C.
IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
IPR008971. HSP40/DnaJ_pept-bd.
IPR001305. HSP_DnaJ_Cys-rich_dom.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
PF01556. DnaJ_C. 1 hit.
PF00684. DnaJ_CXXCXGXG. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
SSF49493. SSF49493. 3 hits.
SSF57938. SSF57938. 1 hit.
PROSITEiPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
PS51188. ZF_CR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDNJA4_HUMAN
AccessioniPrimary (citable) accession number: Q8WW22
Secondary accession number(s): E9PDM9
, Q6AW87, Q8N5Z4, Q8N7P2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: March 1, 2002
Last modified: November 30, 2016
This is version 132 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.