Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WW22

- DNJA4_HUMAN

UniProt

Q8WW22 - DNJA4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

DnaJ homolog subfamily A member 4

Gene

DNAJA4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi135 – 1351Zinc 1By similarity
Metal bindingi138 – 1381Zinc 1By similarity
Metal bindingi151 – 1511Zinc 2By similarity
Metal bindingi154 – 1541Zinc 2By similarity
Metal bindingi178 – 1781Zinc 2By similarity
Metal bindingi181 – 1811Zinc 2By similarity
Metal bindingi194 – 1941Zinc 1By similarity
Metal bindingi197 – 1971Zinc 1By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri122 – 20685CR-typeAdd
BLAST

GO - Molecular functioni

  1. ATP binding Source: InterPro
  2. chaperone binding Source: UniProt
  3. metal ion binding Source: UniProtKB-KW
  4. unfolded protein binding Source: UniProt

GO - Biological processi

  1. negative regulation of inclusion body assembly Source: UniProt
  2. protein refolding Source: UniProt
  3. response to heat Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily A member 4
Gene namesi
Name:DNAJA4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:14885. DNAJA4.

Subcellular locationi

Membrane Curated; Lipid-anchor Curated

GO - Cellular componenti

  1. cytosol Source: UniProt
  2. membrane Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27411.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 394394DnaJ homolog subfamily A member 4PRO_0000071014Add
BLAST
Propeptidei395 – 3973Removed in mature formBy similarityPRO_0000396760

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei394 – 3941Cysteine methyl esterBy similarity
Lipidationi394 – 3941S-farnesyl cysteineBy similarity

Keywords - PTMi

Lipoprotein, Methylation, Prenylation

Proteomic databases

MaxQBiQ8WW22.
PaxDbiQ8WW22.
PRIDEiQ8WW22.

PTM databases

PhosphoSiteiQ8WW22.

Expressioni

Gene expression databases

BgeeiQ8WW22.
CleanExiHS_DNAJA4.
ExpressionAtlasiQ8WW22. baseline and differential.
GenevestigatoriQ8WW22.

Organism-specific databases

HPAiCAB004646.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DNAJA2O608842EBI-2555157,EBI-352957
ENDOGQ142492EBI-2555157,EBI-9369928

Protein-protein interaction databases

BioGridi120675. 16 interactions.
IntActiQ8WW22. 16 interactions.
STRINGi9606.ENSP00000378324.

Structurei

3D structure databases

ProteinModelPortaliQ8WW22.
SMRiQ8WW22. Positions 1-331.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 7067JAdd
BLAST
Repeati135 – 1428CXXCXGXG motif
Repeati151 – 1588CXXCXGXG motif
Repeati178 – 1858CXXCXGXG motif
Repeati194 – 2018CXXCXGXG motif

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi75 – 9622Gly-richAdd
BLAST

Sequence similaritiesi

Contains 1 CR-type zinc finger.Curated
Contains 1 J domain.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri122 – 20685CR-typeAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG0484.
GeneTreeiENSGT00490000043321.
HOGENOMiHOG000226718.
HOVERGENiHBG066727.
InParanoidiQ8WW22.
KOiK09505.
OMAiPNEQNWR.
OrthoDBiEOG7XM2XK.
PhylomeDBiQ8WW22.
TreeFamiTF105141.

Family and domain databases

Gene3Di1.10.287.110. 1 hit.
2.10.230.10. 1 hit.
HAMAPiMF_01152. DnaJ.
InterProiIPR012724. DnaJ.
IPR002939. DnaJ_C.
IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
IPR008971. HSP40/DnaJ_pept-bd.
IPR001305. HSP_DnaJ_Cys-rich_dom.
[Graphical view]
PfamiPF01556. CTDII. 1 hit.
PF00226. DnaJ. 1 hit.
PF00684. DnaJ_CXXCXGXG. 1 hit.
[Graphical view]
PRINTSiPR00625. JDOMAIN.
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
SSF49493. SSF49493. 3 hits.
SSF57938. SSF57938. 1 hit.
PROSITEiPS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
PS51188. ZF_CR. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WW22-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKETQYYDI LGVKPSASPE EIKKAYRKLA LKYHPDKNPD EGEKFKLISQ
60 70 80 90 100
AYEVLSDPKK RDVYDQGGEQ AIKEGGSGSP SFSSPMDIFD MFFGGGGRMA
110 120 130 140 150
RERRGKNVVH QLSVTLEDLY NGVTKKLALQ KNVICEKCEG VGGKKGSVEK
160 170 180 190 200
CPLCKGRGMQ IHIQQIGPGM VQQIQTVCIE CKGQGERINP KDRCESCSGA
210 220 230 240 250
KVIREKKIIE VHVEKGMKDG QKILFHGEGD QEPELEPGDV IIVLDQKDHS
260 270 280 290 300
VFQRRGHDLI MKMKIQLSEA LCGFKKTIKT LDNRILVITS KAGEVIKHGD
310 320 330 340 350
LRCVRDEGMP IYKAPLEKGI LIIQFLVIFP EKHWLSLEKL PQLEALLPPR
360 370 380 390
QKVRITDDMD QVELKEFCPN EQNWRQHREA YEEDEDGPQA GVQCQTA
Length:397
Mass (Da):44,798
Last modified:March 1, 2002 - v1
Checksum:i60D6AAD12C9B2529
GO
Isoform 2 (identifier: Q8WW22-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARGGSQSWSSGESDGQPKEQTPEKPRHKM

Show »
Length:426
Mass (Da):47,963
Checksum:i820C0BE7F54EB221
GO
Isoform 3 (identifier: Q8WW22-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEK → MWESLTLDSGQISALTR

Note: No experimental confirmation available.Curated

Show »
Length:370
Mass (Da):41,597
Checksum:i3FCEABA5F96D48A2
GO

Sequence cautioni

The sequence AAH21720.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH31044.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti33 – 331Y → C in BAC05229. (PubMed:14702039)Curated
Isoform 3 (identifier: Q8WW22-3)
Sequence conflicti1 – 11M → T in AAH31044. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti226 – 2261H → R.1 Publication
Corresponds to variant rs17852881 [ dbSNP | Ensembl ].
VAR_069064

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4444MVKET…DEGEK → MWESLTLDSGQISALTR in isoform 3. 1 PublicationVSP_045696Add
BLAST
Alternative sequencei1 – 11M → MARGGSQSWSSGESDGQPKE QTPEKPRHKM in isoform 2. 2 PublicationsVSP_038965

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096616 mRNA. Translation: BAC04828.1.
AK098079 mRNA. Translation: BAC05229.1.
BX648710 mRNA. Translation: CAH10558.1.
AC092755 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99177.1.
BC021720 mRNA. Translation: AAH21720.1. Different initiation.
BC031044 mRNA. Translation: AAH31044.2. Different initiation.
CCDSiCCDS10299.2. [Q8WW22-2]
CCDS45316.1. [Q8WW22-1]
CCDS45317.1. [Q8WW22-3]
RefSeqiNP_001123654.1. NM_001130182.1. [Q8WW22-1]
NP_001123655.1. NM_001130183.1. [Q8WW22-3]
NP_061072.3. NM_018602.3. [Q8WW22-2]
XP_005254592.1. XM_005254535.1. [Q8WW22-1]
XP_006720664.1. XM_006720601.1. [Q8WW22-1]
UniGeneiHs.513053.

Genome annotation databases

EnsembliENST00000343789; ENSP00000339581; ENSG00000140403. [Q8WW22-1]
ENST00000394852; ENSP00000378321; ENSG00000140403. [Q8WW22-1]
ENST00000394855; ENSP00000378324; ENSG00000140403. [Q8WW22-2]
ENST00000446172; ENSP00000413499; ENSG00000140403. [Q8WW22-3]
GeneIDi55466.
KEGGihsa:55466.
UCSCiuc002bdi.3. human. [Q8WW22-2]
uc002bdj.2. human. [Q8WW22-1]

Polymorphism databases

DMDMi27805462.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096616 mRNA. Translation: BAC04828.1 .
AK098079 mRNA. Translation: BAC05229.1 .
BX648710 mRNA. Translation: CAH10558.1 .
AC092755 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99177.1 .
BC021720 mRNA. Translation: AAH21720.1 . Different initiation.
BC031044 mRNA. Translation: AAH31044.2 . Different initiation.
CCDSi CCDS10299.2. [Q8WW22-2 ]
CCDS45316.1. [Q8WW22-1 ]
CCDS45317.1. [Q8WW22-3 ]
RefSeqi NP_001123654.1. NM_001130182.1. [Q8WW22-1 ]
NP_001123655.1. NM_001130183.1. [Q8WW22-3 ]
NP_061072.3. NM_018602.3. [Q8WW22-2 ]
XP_005254592.1. XM_005254535.1. [Q8WW22-1 ]
XP_006720664.1. XM_006720601.1. [Q8WW22-1 ]
UniGenei Hs.513053.

3D structure databases

ProteinModelPortali Q8WW22.
SMRi Q8WW22. Positions 1-331.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120675. 16 interactions.
IntActi Q8WW22. 16 interactions.
STRINGi 9606.ENSP00000378324.

PTM databases

PhosphoSitei Q8WW22.

Polymorphism databases

DMDMi 27805462.

Proteomic databases

MaxQBi Q8WW22.
PaxDbi Q8WW22.
PRIDEi Q8WW22.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000343789 ; ENSP00000339581 ; ENSG00000140403 . [Q8WW22-1 ]
ENST00000394852 ; ENSP00000378321 ; ENSG00000140403 . [Q8WW22-1 ]
ENST00000394855 ; ENSP00000378324 ; ENSG00000140403 . [Q8WW22-2 ]
ENST00000446172 ; ENSP00000413499 ; ENSG00000140403 . [Q8WW22-3 ]
GeneIDi 55466.
KEGGi hsa:55466.
UCSCi uc002bdi.3. human. [Q8WW22-2 ]
uc002bdj.2. human. [Q8WW22-1 ]

Organism-specific databases

CTDi 55466.
GeneCardsi GC15P078556.
HGNCi HGNC:14885. DNAJA4.
HPAi CAB004646.
neXtProti NX_Q8WW22.
PharmGKBi PA27411.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0484.
GeneTreei ENSGT00490000043321.
HOGENOMi HOG000226718.
HOVERGENi HBG066727.
InParanoidi Q8WW22.
KOi K09505.
OMAi PNEQNWR.
OrthoDBi EOG7XM2XK.
PhylomeDBi Q8WW22.
TreeFami TF105141.

Miscellaneous databases

ChiTaRSi DNAJA4. human.
GenomeRNAii 55466.
NextBioi 59854.
PROi Q8WW22.

Gene expression databases

Bgeei Q8WW22.
CleanExi HS_DNAJA4.
ExpressionAtlasi Q8WW22. baseline and differential.
Genevestigatori Q8WW22.

Family and domain databases

Gene3Di 1.10.287.110. 1 hit.
2.10.230.10. 1 hit.
HAMAPi MF_01152. DnaJ.
InterProi IPR012724. DnaJ.
IPR002939. DnaJ_C.
IPR001623. DnaJ_domain.
IPR018253. DnaJ_domain_CS.
IPR008971. HSP40/DnaJ_pept-bd.
IPR001305. HSP_DnaJ_Cys-rich_dom.
[Graphical view ]
Pfami PF01556. CTDII. 1 hit.
PF00226. DnaJ. 1 hit.
PF00684. DnaJ_CXXCXGXG. 1 hit.
[Graphical view ]
PRINTSi PR00625. JDOMAIN.
SMARTi SM00271. DnaJ. 1 hit.
[Graphical view ]
SUPFAMi SSF46565. SSF46565. 1 hit.
SSF49493. SSF49493. 3 hits.
SSF57938. SSF57938. 1 hit.
PROSITEi PS00636. DNAJ_1. 1 hit.
PS50076. DNAJ_2. 1 hit.
PS51188. ZF_CR. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Trachea.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Endometrial tumor.
  3. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT ARG-226.
    Tissue: Brain and Testis.
  6. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiDNJA4_HUMAN
AccessioniPrimary (citable) accession number: Q8WW22
Secondary accession number(s): E9PDM9
, Q6AW87, Q8N5Z4, Q8N7P2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: March 1, 2002
Last modified: October 29, 2014
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3