SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WW01

- SEN15_HUMAN

UniProt

Q8WW01 - SEN15_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

tRNA-splicing endonuclease subunit Sen15

Gene
TSEN15, C1orf19, SEN15
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.1 Publication

GO - Molecular functioni

  1. tRNA-intron endonuclease activity Source: InterPro

GO - Biological processi

  1. mRNA processing Source: UniProtKB-KW
  2. tRNA splicing, via endonucleolytic cleavage and ligation Source: InterPro
Complete GO annotation...

Keywords - Biological processi

mRNA processing, tRNA processing

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA-splicing endonuclease subunit Sen15
Alternative name(s):
SEN15 homolog
Short name:
HsSEN15
tRNA-intron endonuclease Sen15
Gene namesi
Name:TSEN15
Synonyms:C1orf19, SEN15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:16791. TSEN15.

Subcellular locationi

Nucleus Inferred. Nucleusnucleolus Inferred
Note: May be transiently localized in the nucleolus Inferred.

GO - Cellular componenti

  1. nucleolus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162407135.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 171171tRNA-splicing endonuclease subunit Sen15PRO_0000194023Add
BLAST

Proteomic databases

MaxQBiQ8WW01.
PaxDbiQ8WW01.
PRIDEiQ8WW01.

PTM databases

PhosphoSiteiQ8WW01.

Expressioni

Tissue specificityi

Widely expressed. Highly expressed in testis and uterus.1 Publication

Gene expression databases

ArrayExpressiQ8WW01.
BgeeiQ8WW01.
CleanExiHS_TSEN15.
GenevestigatoriQ8WW01.

Organism-specific databases

HPAiHPA029237.

Interactioni

Subunit structurei

Homodimer. tRNA splicing endonuclease is a heterotetramer composed of SEN2, SEN15, SEN34/LENG5 and SEN54. tRNA splicing endonuclease complex also contains proteins of the Pre-mRNA 3' end processing machinery such as CLP1, CPSF1, CPSF4 and CSTF2.1 Publication

Protein-protein interaction databases

BioGridi125513. 9 interactions.
IntActiQ8WW01. 4 interactions.
MINTiMINT-1193061.
STRINGi9606.ENSP00000355299.

Structurei

Secondary structure

1
171
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi44 – 507
Beta strandi52 – 543
Helixi57 – 7216
Beta strandi77 – 848
Turni85 – 884
Beta strandi89 – 979
Beta strandi104 – 1096
Beta strandi113 – 1153
Helixi116 – 12914
Beta strandi138 – 1447
Beta strandi150 – 1567

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2GW6NMR-A/B36-157[»]
ProteinModelPortaliQ8WW01.
SMRiQ8WW01. Positions 36-157.

Miscellaneous databases

EvolutionaryTraceiQ8WW01.

Family & Domainsi

Sequence similaritiesi

Belongs to the SEN15 family.

Phylogenomic databases

eggNOGiNOG44101.
HOGENOMiHOG000290172.
HOVERGENiHBG058504.
InParanoidiQ8WW01.
KOiK15324.
OMAiDASQVYI.
OrthoDBiEOG757D0M.
PhylomeDBiQ8WW01.
TreeFamiTF336144.

Family and domain databases

InterProiIPR018593. tRNA-endonuc_su_Sen15.
IPR006677. tRNA_intron_Endonuc_cat-like.
[Graphical view]
PfamiPF09631. Sen15. 1 hit.
[Graphical view]
SUPFAMiSSF53032. SSF53032. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WW01-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEERGDSEPT PGCSGLGPGG VRGFGDGGGA PSWAPEDAWM GTHPKYLEMM    50
ELDIGDATQV YVAFLVYLDL MESKSWHEVN CVGLPELQLI CLVGTEIEGE 100
GLQTVVPTPI TASLSHNRIR EILKASRKLQ GDPDLPMSFT LAIVESDSTI 150
VYYKLTDGFM LPDPQNISLR R 171
Length:171
Mass (Da):18,641
Last modified:March 1, 2002 - v1
Checksum:iE728BF39A89DD1FB
GO
Isoform 2 (identifier: Q8WW01-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     120-171: REILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR → FLLEDDIHVS

Note: No experimental confirmation available.

Show »
Length:129
Mass (Da):13,888
Checksum:i681214969EA67A76
GO

Sequence cautioni

The sequence AAG60614.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti19 – 191G → D.
Corresponds to variant rs2274432 [ dbSNP | Ensembl ].
VAR_019457
Natural varianti59 – 591Q → H.
Corresponds to variant rs1046934 [ dbSNP | Ensembl ].
VAR_019458

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei120 – 17152REILK…ISLRR → FLLEDDIHVS in isoform 2. VSP_042723Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF288394 mRNA. Translation: AAG60614.1. Different initiation.
AK296655 mRNA. Translation: BAG59252.1.
AL157943 Genomic DNA. No translation available.
AL158011 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91174.1.
BC022030 mRNA. Translation: AAH22030.1.
CCDSiCCDS1361.1. [Q8WW01-1]
CCDS44286.1. [Q8WW01-2]
RefSeqiNP_001120866.1. NM_001127394.2. [Q8WW01-2]
NP_443197.1. NM_052965.2. [Q8WW01-1]
UniGeneiHs.548197.

Genome annotation databases

EnsembliENST00000361641; ENSP00000355299; ENSG00000198860. [Q8WW01-1]
ENST00000423085; ENSP00000402002; ENSG00000198860. [Q8WW01-2]
GeneIDi116461.
KEGGihsa:116461.
UCSCiuc001gqt.4. human. [Q8WW01-1]
uc001gqu.4. human. [Q8WW01-2]

Polymorphism databases

DMDMi50401628.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF288394 mRNA. Translation: AAG60614.1 . Different initiation.
AK296655 mRNA. Translation: BAG59252.1 .
AL157943 Genomic DNA. No translation available.
AL158011 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91174.1 .
BC022030 mRNA. Translation: AAH22030.1 .
CCDSi CCDS1361.1. [Q8WW01-1 ]
CCDS44286.1. [Q8WW01-2 ]
RefSeqi NP_001120866.1. NM_001127394.2. [Q8WW01-2 ]
NP_443197.1. NM_052965.2. [Q8WW01-1 ]
UniGenei Hs.548197.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2GW6 NMR - A/B 36-157 [» ]
ProteinModelPortali Q8WW01.
SMRi Q8WW01. Positions 36-157.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 125513. 9 interactions.
IntActi Q8WW01. 4 interactions.
MINTi MINT-1193061.
STRINGi 9606.ENSP00000355299.

PTM databases

PhosphoSitei Q8WW01.

Polymorphism databases

DMDMi 50401628.

Proteomic databases

MaxQBi Q8WW01.
PaxDbi Q8WW01.
PRIDEi Q8WW01.

Protocols and materials databases

DNASUi 116461.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361641 ; ENSP00000355299 ; ENSG00000198860 . [Q8WW01-1 ]
ENST00000423085 ; ENSP00000402002 ; ENSG00000198860 . [Q8WW01-2 ]
GeneIDi 116461.
KEGGi hsa:116461.
UCSCi uc001gqt.4. human. [Q8WW01-1 ]
uc001gqu.4. human. [Q8WW01-2 ]

Organism-specific databases

CTDi 116461.
GeneCardsi GC01P184020.
HGNCi HGNC:16791. TSEN15.
HPAi HPA029237.
MIMi 608756. gene.
neXtProti NX_Q8WW01.
PharmGKBi PA162407135.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44101.
HOGENOMi HOG000290172.
HOVERGENi HBG058504.
InParanoidi Q8WW01.
KOi K15324.
OMAi DASQVYI.
OrthoDBi EOG757D0M.
PhylomeDBi Q8WW01.
TreeFami TF336144.

Miscellaneous databases

EvolutionaryTracei Q8WW01.
GeneWikii C1orf19.
GenomeRNAii 116461.
NextBioi 79944.
PROi Q8WW01.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8WW01.
Bgeei Q8WW01.
CleanExi HS_TSEN15.
Genevestigatori Q8WW01.

Family and domain databases

InterProi IPR018593. tRNA-endonuc_su_Sen15.
IPR006677. tRNA_intron_Endonuc_cat-like.
[Graphical view ]
Pfami PF09631. Sen15. 1 hit.
[Graphical view ]
SUPFAMi SSF53032. SSF53032. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus."
    Sood R., Bonner T.I., Malakowska I., Stephan D.A., Robbins C.M., Connors T.D., Morgenbesser S.D., Su K., Faruque M.U., Pinkett H., Graham C., Baxevanis A.D., Klinger K.W., Landes G.M., Trent J.M., Carpten J.D.
    Genomics 73:211-222(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Colon.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  6. "Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation."
    Paushkin S.V., Patel M., Furia B.S., Peltz S.W., Trotta C.R.
    Cell 117:311-321(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL PROTEIN SEQUENCE, FUNCTION, COMPONENT OF A COMPLEX WITH SEN2; SEN54; SEN34 AND CLP1.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Three-dimensional structure determined for a subunit of human tRNA splicing endonuclease (Sen15) reveals a novel dimeric fold."
    Song J., Markley J.L.
    J. Mol. Biol. 366:155-164(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 36-157, SUBUNIT.

Entry informationi

Entry nameiSEN15_HUMAN
AccessioniPrimary (citable) accession number: Q8WW01
Secondary accession number(s): B4DKP0, Q9BZQ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: March 1, 2002
Last modified: July 9, 2014
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi