Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

tRNA-splicing endonuclease subunit Sen15

Gene

TSEN15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

mRNA processing, tRNA processing

Enzyme and pathway databases

BioCyciZFISH:HS13020-MONOMER.
ReactomeiR-HSA-6784531. tRNA processing in the nucleus.

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA-splicing endonuclease subunit Sen15
Alternative name(s):
SEN15 homolog
Short name:
HsSEN15
tRNA-intron endonuclease Sen15
Gene namesi
Name:TSEN15
Synonyms:C1orf19, SEN15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:16791. TSEN15.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi116461.
OpenTargetsiENSG00000198860.
PharmGKBiPA162407135.

Polymorphism and mutation databases

BioMutaiTSEN15.
DMDMi50401628.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001940231 – 171tRNA-splicing endonuclease subunit Sen15Add BLAST171

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei7PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8WW01.
MaxQBiQ8WW01.
PaxDbiQ8WW01.
PeptideAtlasiQ8WW01.
PRIDEiQ8WW01.

PTM databases

iPTMnetiQ8WW01.
PhosphoSitePlusiQ8WW01.

Expressioni

Tissue specificityi

Widely expressed. Highly expressed in testis and uterus.1 Publication

Gene expression databases

BgeeiENSG00000198860.
CleanExiHS_TSEN15.
ExpressionAtlasiQ8WW01. baseline and differential.
GenevisibleiQ8WW01. HS.

Organism-specific databases

HPAiHPA029237.

Interactioni

Subunit structurei

Homodimer. tRNA splicing endonuclease is a heterotetramer composed of SEN2, SEN15, SEN34/LENG5 and SEN54. tRNA splicing endonuclease complex also contains proteins of the Pre-mRNA 3' end processing machinery such as CLP1, CPSF1, CPSF4 and CSTF2.1 Publication

Protein-protein interaction databases

BioGridi125513. 12 interactors.
IntActiQ8WW01. 11 interactors.
MINTiMINT-1193061.
STRINGi9606.ENSP00000355299.

Structurei

Secondary structure

1171
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi44 – 50Combined sources7
Beta strandi52 – 54Combined sources3
Helixi57 – 72Combined sources16
Beta strandi77 – 84Combined sources8
Turni85 – 88Combined sources4
Beta strandi89 – 97Combined sources9
Beta strandi104 – 109Combined sources6
Beta strandi113 – 115Combined sources3
Helixi116 – 129Combined sources14
Beta strandi138 – 144Combined sources7
Beta strandi150 – 156Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GW6NMR-A/B36-157[»]
ProteinModelPortaliQ8WW01.
SMRiQ8WW01.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WW01.

Family & Domainsi

Sequence similaritiesi

Belongs to the SEN15 family.Curated

Phylogenomic databases

eggNOGiENOG410IYHQ. Eukaryota.
ENOG41120H2. LUCA.
GeneTreeiENSGT00390000014781.
HOGENOMiHOG000290172.
HOVERGENiHBG058504.
InParanoidiQ8WW01.
KOiK15324.
OMAiCLLGTEI.
OrthoDBiEOG091G0T33.
PhylomeDBiQ8WW01.
TreeFamiTF336144.

Family and domain databases

InterProiIPR018593. tRNA-endonuc_su_Sen15.
IPR006677. tRNA_intron_Endonuc_cat-like.
[Graphical view]
PfamiPF09631. Sen15. 1 hit.
[Graphical view]
SUPFAMiSSF53032. SSF53032. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WW01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEERGDSEPT PGCSGLGPGG VRGFGDGGGA PSWAPEDAWM GTHPKYLEMM
60 70 80 90 100
ELDIGDATQV YVAFLVYLDL MESKSWHEVN CVGLPELQLI CLVGTEIEGE
110 120 130 140 150
GLQTVVPTPI TASLSHNRIR EILKASRKLQ GDPDLPMSFT LAIVESDSTI
160 170
VYYKLTDGFM LPDPQNISLR R
Length:171
Mass (Da):18,641
Last modified:March 1, 2002 - v1
Checksum:iE728BF39A89DD1FB
GO
Isoform 2 (identifier: Q8WW01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     120-171: REILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR → FLLEDDIHVS

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):13,888
Checksum:i681214969EA67A76
GO

Sequence cautioni

The sequence AAG60614 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01945719G → D.Corresponds to variant rs2274432dbSNPEnsembl.1
Natural variantiVAR_01945859Q → H.Corresponds to variant rs1046934dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042723120 – 171REILK…ISLRR → FLLEDDIHVS in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF288394 mRNA. Translation: AAG60614.1. Different initiation.
AK296655 mRNA. Translation: BAG59252.1.
AL157943 Genomic DNA. No translation available.
AL158011 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91174.1.
BC022030 mRNA. Translation: AAH22030.1.
CCDSiCCDS1361.1. [Q8WW01-1]
CCDS44286.1. [Q8WW01-2]
RefSeqiNP_001120866.1. NM_001127394.3. [Q8WW01-2]
NP_001287693.1. NM_001300764.1.
NP_001287695.1. NM_001300766.1.
NP_443197.1. NM_052965.3. [Q8WW01-1]
UniGeneiHs.548197.

Genome annotation databases

EnsembliENST00000361641; ENSP00000355299; ENSG00000198860. [Q8WW01-1]
ENST00000423085; ENSP00000402002; ENSG00000198860. [Q8WW01-2]
GeneIDi116461.
KEGGihsa:116461.
UCSCiuc001gqt.5. human. [Q8WW01-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF288394 mRNA. Translation: AAG60614.1. Different initiation.
AK296655 mRNA. Translation: BAG59252.1.
AL157943 Genomic DNA. No translation available.
AL158011 Genomic DNA. No translation available.
CH471067 Genomic DNA. Translation: EAW91174.1.
BC022030 mRNA. Translation: AAH22030.1.
CCDSiCCDS1361.1. [Q8WW01-1]
CCDS44286.1. [Q8WW01-2]
RefSeqiNP_001120866.1. NM_001127394.3. [Q8WW01-2]
NP_001287693.1. NM_001300764.1.
NP_001287695.1. NM_001300766.1.
NP_443197.1. NM_052965.3. [Q8WW01-1]
UniGeneiHs.548197.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GW6NMR-A/B36-157[»]
ProteinModelPortaliQ8WW01.
SMRiQ8WW01.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125513. 12 interactors.
IntActiQ8WW01. 11 interactors.
MINTiMINT-1193061.
STRINGi9606.ENSP00000355299.

PTM databases

iPTMnetiQ8WW01.
PhosphoSitePlusiQ8WW01.

Polymorphism and mutation databases

BioMutaiTSEN15.
DMDMi50401628.

Proteomic databases

EPDiQ8WW01.
MaxQBiQ8WW01.
PaxDbiQ8WW01.
PeptideAtlasiQ8WW01.
PRIDEiQ8WW01.

Protocols and materials databases

DNASUi116461.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361641; ENSP00000355299; ENSG00000198860. [Q8WW01-1]
ENST00000423085; ENSP00000402002; ENSG00000198860. [Q8WW01-2]
GeneIDi116461.
KEGGihsa:116461.
UCSCiuc001gqt.5. human. [Q8WW01-1]

Organism-specific databases

CTDi116461.
DisGeNETi116461.
GeneCardsiTSEN15.
HGNCiHGNC:16791. TSEN15.
HPAiHPA029237.
MIMi608756. gene.
neXtProtiNX_Q8WW01.
OpenTargetsiENSG00000198860.
PharmGKBiPA162407135.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IYHQ. Eukaryota.
ENOG41120H2. LUCA.
GeneTreeiENSGT00390000014781.
HOGENOMiHOG000290172.
HOVERGENiHBG058504.
InParanoidiQ8WW01.
KOiK15324.
OMAiCLLGTEI.
OrthoDBiEOG091G0T33.
PhylomeDBiQ8WW01.
TreeFamiTF336144.

Enzyme and pathway databases

BioCyciZFISH:HS13020-MONOMER.
ReactomeiR-HSA-6784531. tRNA processing in the nucleus.

Miscellaneous databases

ChiTaRSiTSEN15. human.
EvolutionaryTraceiQ8WW01.
GeneWikiiC1orf19.
GenomeRNAii116461.
PROiQ8WW01.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198860.
CleanExiHS_TSEN15.
ExpressionAtlasiQ8WW01. baseline and differential.
GenevisibleiQ8WW01. HS.

Family and domain databases

InterProiIPR018593. tRNA-endonuc_su_Sen15.
IPR006677. tRNA_intron_Endonuc_cat-like.
[Graphical view]
PfamiPF09631. Sen15. 1 hit.
[Graphical view]
SUPFAMiSSF53032. SSF53032. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSEN15_HUMAN
AccessioniPrimary (citable) accession number: Q8WW01
Secondary accession number(s): B4DKP0, Q9BZQ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: March 1, 2002
Last modified: November 30, 2016
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Although only weakly related to the S.cerevisiae SEN15 protein, it probably displays the same function within the tRNA splicing endonuclease complex.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.