Q8WW01 (SEN15_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: tRNA-splicing endonuclease subunit Sen15 Alternative name(s): SEN15 homolog Short name=HsSEN15 tRNA-intron endonuclease Sen15 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 171 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3' end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3' end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events. Ref.6 |
| Subunit structure | Homodimer. tRNA splicing endonuclease is a heterotetramer composed of SEN2, SEN15, SEN34/LENG5 and SEN54. tRNA splicing endonuclease complex also contains proteins of the Pre-mRNA 3' end processing machinery such as CLP1, CPSF1, CPSF4 and CSTF2. Ref.8 |
| Subcellular location | Nucleus Probable. Nucleus › nucleolus Probable. Note: May be transiently localized in the nucleolus Probable. |
| Tissue specificity | Widely expressed. Highly expressed in testis and uterus. Ref.1 |
| Sequence similarities | Belongs to the SEN15 family. |
| Caution | Although only weakly related to the S.cerevisiae SEN15 protein, it probably displays the same function within the tRNA splicing endonuclease complex. |
| Sequence caution | The sequence AAG60614.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | mRNA processing tRNA processing |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | mRNA processing Inferred from electronic annotation. Source: UniProtKB-KW tRNA processingInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleolus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WW01-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WW01-2) The sequence of this isoform differs from the canonical sequence as follows: 120-171: REILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR → FLLEDDIHVS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 171 | 171 | tRNA-splicing endonuclease subunit Sen15 | PRO_0000194023 | ||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 120 – 171 | 52 | REILK…ISLRR → FLLEDDIHVS in isoform 2. | VSP_042723 | ||||||||||||||||||||||||
| Natural variant | 19 | 1 | G → D. Corresponds to variant rs2274432 [ dbSNP | Ensembl ]. | VAR_019457 | ||||||||||||||||||||||||
| Natural variant | 59 | 1 | Q → H. Corresponds to variant rs1046934 [ dbSNP | Ensembl ]. | VAR_019458 | ||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Helix | 44 – 50 | 7 | ||||||||||||||||||||||||||
| Beta strand | 52 – 54 | 3 | ||||||||||||||||||||||||||
| Helix | 57 – 72 | 16 | ||||||||||||||||||||||||||
| Beta strand | 77 – 84 | 8 | ||||||||||||||||||||||||||
| Turn | 85 – 88 | 4 | ||||||||||||||||||||||||||
| Beta strand | 89 – 97 | 9 | ||||||||||||||||||||||||||
| Beta strand | 104 – 109 | 6 | ||||||||||||||||||||||||||
| Beta strand | 113 – 115 | 3 | ||||||||||||||||||||||||||
| Helix | 116 – 129 | 14 | ||||||||||||||||||||||||||
| Beta strand | 138 – 144 | 7 | ||||||||||||||||||||||||||
| Beta strand | 150 – 156 | 7 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus." Sood R., Bonner T.I., Malakowska I., Stephan D.A., Robbins C.M., Connors T.D., Morgenbesser S.D., Su K., Faruque M.U., Pinkett H., Graham C., Baxevanis A.D., Klinger K.W., Landes G.M., Trent J.M., Carpten J.D. Genomics 73:211-222(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [6] | "Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation." Paushkin S.V., Patel M., Furia B.S., Peltz S.W., Trotta C.R. Cell 117:311-321(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, FUNCTION, COMPONENT OF A COMPLEX WITH SEN2; SEN54; SEN34 AND CLP1. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [8] | "Three-dimensional structure determined for a subunit of human tRNA splicing endonuclease (Sen15) reveals a novel dimeric fold." Song J., Markley J.L. J. Mol. Biol. 366:155-164(2007) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 36-157, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF288394 mRNA. Translation: AAG60614.1. Different initiation. AK296655 mRNA. Translation: BAG59252.1. AL157943 Genomic DNA. No translation available. AL158011 Genomic DNA. No translation available. CH471067 Genomic DNA. Translation: EAW91174.1. BC022030 mRNA. Translation: AAH22030.1. | ||||||||||||
| IPI | IPI00450071. IPI00828179. | ||||||||||||
| RefSeq | NP_001120866.1. NM_001127394.2. NP_443197.1. NM_052965.2. | ||||||||||||
| UniGene | Hs.548197. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8WW01. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q8WW01. 3 interactions. | ||||||||||||
| MINT | MINT-1193061. | ||||||||||||
| STRING | 9606.ENSP00000355299. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8WW01. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 50401628. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q8WW01. | ||||||||||||
| PRIDE | Q8WW01. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 116461. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000361641; ENSP00000355299; ENSG00000198860. ENST00000423085; ENSP00000402002; ENSG00000198860. | ||||||||||||
| GeneID | 116461. | ||||||||||||
| KEGG | hsa:116461. | ||||||||||||
| UCSC | uc001gqt.4. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 116461. | ||||||||||||
| GeneCards | GC01P184020. | ||||||||||||
| HGNC | HGNC:16791. TSEN15. | ||||||||||||
| HPA | HPA029237. | ||||||||||||
| MIM | 608756. gene. | ||||||||||||
| neXtProt | NX_Q8WW01. | ||||||||||||
| PharmGKB | PA162407135. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG44101. | ||||||||||||
| HOGENOM | HOG000290172. | ||||||||||||
| HOVERGEN | HBG058504. | ||||||||||||
| InParanoid | Q8WW01. | ||||||||||||
| KO | K15324. | ||||||||||||
| OMA | CLLGTEI. | ||||||||||||
| OrthoDB | EOG4907BK. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8WW01. | ||||||||||||
| Bgee | Q8WW01. | ||||||||||||
| CleanEx | HS_TSEN15. | ||||||||||||
| Genevestigator | Q8WW01. | ||||||||||||
| GermOnline | ENSG00000198860. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR024369. tRNA-intron_endonuclease_Sen15. [Graphical view] | ||||||||||||
| Pfam | PF12858. tRNA_iecd. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q8WW01. | ||||||||||||
| GenomeRNAi | 116461. | ||||||||||||
| NextBio | 79944. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | SEN15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WW01 Secondary accession number(s): B4DKP0, Q9BZQ5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
