Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heterogeneous nuclear ribonucleoprotein L-like

Gene

HNRNPLL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

RNA-binding protein that functions as regulator of alternative splicing for multiple target mRNAs, including PTPRC/CD45 and STAT5A. Required for alternative splicing of PTPRC.1 Publication

GO - Molecular functioni

  • mRNA binding Source: UniProtKB
  • nucleotide binding Source: InterPro
  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

  • mRNA processing Source: InterPro
  • positive regulation of RNA splicing Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000143889-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Heterogeneous nuclear ribonucleoprotein L-like
Short name:
hnRNPLL
Alternative name(s):
Stromal RNA-regulating factor
Gene namesi
Name:HNRNPLL
Synonyms:HNRPLL, SRRF
ORF Names:BLOCK24
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:25127. HNRNPLL.

Subcellular locationi

GO - Cellular componenti

  • intracellular ribonucleoprotein complex Source: UniProtKB-KW
  • membrane Source: UniProtKB
  • nucleus Source: InterPro
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000143889.
PharmGKBiPA134987080.

Polymorphism and mutation databases

BioMutaiHNRNPLL.
DMDMi62286941.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000816091 – 542Heterogeneous nuclear ribonucleoprotein L-likeAdd BLAST542

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei35PhosphoserineCombined sources1
Modified residuei46PhosphothreonineCombined sources1
Modified residuei59PhosphoserineCombined sources1
Modified residuei68PhosphoserineCombined sources1
Modified residuei75PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8WVV9.
MaxQBiQ8WVV9.
PaxDbiQ8WVV9.
PeptideAtlasiQ8WVV9.
PRIDEiQ8WVV9.

PTM databases

iPTMnetiQ8WVV9.
PhosphoSitePlusiQ8WVV9.

Expressioni

Tissue specificityi

Widely expressed. Detected in bone marrow stroma cells, skeletal muscle, heart, placenta, pancreas, kidney and lung.1 Publication

Inductioni

Up-regulated in stimulated T-cells.1 Publication

Gene expression databases

BgeeiENSG00000143889.
CleanExiHS_HNRPLL.
ExpressionAtlasiQ8WVV9. baseline and differential.
GenevisibleiQ8WVV9. HS.

Organism-specific databases

HPAiHPA046084.

Interactioni

Subunit structurei

Interacts with HNRNPL.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
BOLLQ8N9W63EBI-535849,EBI-998198
DAB1O755533EBI-535849,EBI-7875264
HNRNPKP619783EBI-535849,EBI-304185
HNRPKQ6IBN15EBI-535849,EBI-3440248
MDFIQ997504EBI-535849,EBI-724076
QKIQ96PU83EBI-535849,EBI-945792
RBPMSQ930623EBI-535849,EBI-740322
RHOXF2Q9BQY43EBI-535849,EBI-372094
THAP1Q9NVV93EBI-535849,EBI-741515
UBE2IQ7KZS03EBI-535849,EBI-10180829

Protein-protein interaction databases

BioGridi124985. 57 interactors.
IntActiQ8WVV9. 13 interactors.
MINTiMINT-1033123.
STRINGi9606.ENSP00000387088.

Structurei

3D structure databases

ProteinModelPortaliQ8WVV9.
SMRiQ8WVV9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini76 – 150RRM 1PROSITE-ProRule annotationAdd BLAST75
Domaini166 – 244RRM 2PROSITE-ProRule annotationAdd BLAST79
Domaini335 – 409RRM 3PROSITE-ProRule annotationAdd BLAST75

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi2 – 7Poly-Ser6
Compositional biasi49 – 57Poly-Gly9

Sequence similaritiesi

Contains 3 RRM (RNA recognition motif) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1456. Eukaryota.
ENOG410XQHN. LUCA.
GeneTreeiENSGT00550000074508.
HOGENOMiHOG000293298.
HOVERGENiHBG105786.
InParanoidiQ8WVV9.
KOiK13159.
OMAiQIRIPNG.
PhylomeDBiQ8WVV9.
TreeFamiTF354318.

Family and domain databases

Gene3Di3.30.70.330. 4 hits.
InterProiIPR006536. HnRNP-L/PTB.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 2 hits.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 3 hits.
TIGRFAMsiTIGR01649. hnRNP-L_PTB. 1 hit.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WVV9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSSSSSPRE TYEEDREYES QAKRLKTEEG EIDYSAEEGE NRREATPRGG
60 70 80 90 100
GDGGGGGRSF SQPEAGGSHH KVSVSPVVHV RGLCESVVEA DLVEALEKFG
110 120 130 140 150
TICYVMMMPF KRQALVEFEN IDSAKECVTF AADEPVYIAG QQAFFNYSTS
160 170 180 190 200
KRITRPGNTD DPSGGNKVLL LSIQNPLYPI TVDVLYTVCN PVGKVQRIVI
210 220 230 240 250
FKRNGIQAMV EFESVLCAQK AKAALNGADI YAGCCTLKIE YARPTRLNVI
260 270 280 290 300
RNDNDSWDYT KPYLGRRDRG KGRQRQAILG EHPSSFRHDG YGSHGPLLPL
310 320 330 340 350
PSRYRMGSRD TPELVAYPLP QASSSYMHGG NPSGSVVMVS GLHQLKMNCS
360 370 380 390 400
RVFNLFCLYG NIEKVKFMKT IPGTALVEMG DEYAVERAVT HLNNVKLFGK
410 420 430 440 450
RLNVCVSKQH SVVPSQIFEL EDGTSSYKDF AMSKNNRFTS AGQASKNIIQ
460 470 480 490 500
PPSCVLHYYN VPLCVTEETF TKLCNDHEVL TFIKYKVFDA KPSAKTLSGL
510 520 530 540
LEWECKTDAV EALTALNHYQ IRVPNGSNPY TLKLCFSTSS HL
Length:542
Mass (Da):60,083
Last modified:March 1, 2002 - v1
Checksum:i466FAAB47B4C59D3
GO
Isoform 2 (identifier: Q8WVV9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     268-282: DRGKGRQRQAILGEH → GCCWLMLKLLERSPL
     283-542: Missing.

Note: No experimental confirmation available.
Show »
Length:282
Mass (Da):31,232
Checksum:iD432953BCB303758
GO
Isoform 3 (identifier: Q8WVV9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MSSSSSSP → MLA
     268-280: DRGKGRQRQAILG → GRYFIHFRMYLIC
     281-542: Missing.

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):30,754
Checksum:i046627120FC11018
GO
Isoform 4 (identifier: Q8WVV9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-8: MSSSSSSP → MLA

Note: No experimental confirmation available.
Show »
Length:537
Mass (Da):59,648
Checksum:i17EE18A70649654B
GO
Isoform 5 (identifier: Q8WVV9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-245: EFESVLCAQKAKAALNGADIYAGCCTLKIEYARPT → D

Show »
Length:508
Mass (Da):56,467
Checksum:iF9E4F3C5344F4D0F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0132851 – 8MSSSSSSP → MLA in isoform 3 and isoform 4. 2 Publications8
Alternative sequenceiVSP_054470211 – 245EFESV…YARPT → D in isoform 5. CuratedAdd BLAST35
Alternative sequenceiVSP_013286268 – 282DRGKG…ILGEH → GCCWLMLKLLERSPL in isoform 2. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_013288268 – 280DRGKG…QAILG → GRYFIHFRMYLIC in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_013289281 – 542Missing in isoform 3. 1 PublicationAdd BLAST262
Alternative sequenceiVSP_013287283 – 542Missing in isoform 2. 2 PublicationsAdd BLAST260

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY236963 mRNA. Translation: AAQ20084.2.
AF461722
, AF461712, AF461713, AF461715, AF461717, AF461719, AF461721, AF461720, AF461718, AF461716, AF461714 Genomic DNA. Translation: AAN76189.1.
AF461716
, AF461712, AF461713, AF461715, AF461714 Genomic DNA. Translation: AAN76190.1.
AY236962 mRNA. Translation: AAQ20083.1.
AK291462 mRNA. Translation: BAF84151.1.
AC011247 Genomic DNA. Translation: AAY24302.1.
BC008217 mRNA. Translation: AAH08217.2.
BC017480 mRNA. Translation: AAH17480.1.
AL512692 mRNA. Translation: CAH56358.1.
CCDSiCCDS1796.2. [Q8WVV9-1]
CCDS46261.1. [Q8WVV9-4]
RefSeqiNP_001136122.1. NM_001142650.1. [Q8WVV9-4]
NP_612403.2. NM_138394.3. [Q8WVV9-1]
UniGeneiHs.445497.

Genome annotation databases

EnsembliENST00000409328; ENSP00000386575; ENSG00000143889. [Q8WVV9-5]
ENST00000409636; ENSP00000387088; ENSG00000143889. [Q8WVV9-4]
ENST00000410076; ENSP00000386695; ENSG00000143889. [Q8WVV9-3]
ENST00000449105; ENSP00000390625; ENSG00000143889. [Q8WVV9-1]
GeneIDi92906.
KEGGihsa:92906.
UCSCiuc021vgb.2. human. [Q8WVV9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY236963 mRNA. Translation: AAQ20084.2.
AF461722
, AF461712, AF461713, AF461715, AF461717, AF461719, AF461721, AF461720, AF461718, AF461716, AF461714 Genomic DNA. Translation: AAN76189.1.
AF461716
, AF461712, AF461713, AF461715, AF461714 Genomic DNA. Translation: AAN76190.1.
AY236962 mRNA. Translation: AAQ20083.1.
AK291462 mRNA. Translation: BAF84151.1.
AC011247 Genomic DNA. Translation: AAY24302.1.
BC008217 mRNA. Translation: AAH08217.2.
BC017480 mRNA. Translation: AAH17480.1.
AL512692 mRNA. Translation: CAH56358.1.
CCDSiCCDS1796.2. [Q8WVV9-1]
CCDS46261.1. [Q8WVV9-4]
RefSeqiNP_001136122.1. NM_001142650.1. [Q8WVV9-4]
NP_612403.2. NM_138394.3. [Q8WVV9-1]
UniGeneiHs.445497.

3D structure databases

ProteinModelPortaliQ8WVV9.
SMRiQ8WVV9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124985. 57 interactors.
IntActiQ8WVV9. 13 interactors.
MINTiMINT-1033123.
STRINGi9606.ENSP00000387088.

PTM databases

iPTMnetiQ8WVV9.
PhosphoSitePlusiQ8WVV9.

Polymorphism and mutation databases

BioMutaiHNRNPLL.
DMDMi62286941.

Proteomic databases

EPDiQ8WVV9.
MaxQBiQ8WVV9.
PaxDbiQ8WVV9.
PeptideAtlasiQ8WVV9.
PRIDEiQ8WVV9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409328; ENSP00000386575; ENSG00000143889. [Q8WVV9-5]
ENST00000409636; ENSP00000387088; ENSG00000143889. [Q8WVV9-4]
ENST00000410076; ENSP00000386695; ENSG00000143889. [Q8WVV9-3]
ENST00000449105; ENSP00000390625; ENSG00000143889. [Q8WVV9-1]
GeneIDi92906.
KEGGihsa:92906.
UCSCiuc021vgb.2. human. [Q8WVV9-1]

Organism-specific databases

CTDi92906.
GeneCardsiHNRNPLL.
HGNCiHGNC:25127. HNRNPLL.
HPAiHPA046084.
MIMi611208. gene.
neXtProtiNX_Q8WVV9.
OpenTargetsiENSG00000143889.
PharmGKBiPA134987080.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1456. Eukaryota.
ENOG410XQHN. LUCA.
GeneTreeiENSGT00550000074508.
HOGENOMiHOG000293298.
HOVERGENiHBG105786.
InParanoidiQ8WVV9.
KOiK13159.
OMAiQIRIPNG.
PhylomeDBiQ8WVV9.
TreeFamiTF354318.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000143889-MONOMER.

Miscellaneous databases

GenomeRNAii92906.
PROiQ8WVV9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143889.
CleanExiHS_HNRPLL.
ExpressionAtlasiQ8WVV9. baseline and differential.
GenevisibleiQ8WVV9. HS.

Family and domain databases

Gene3Di3.30.70.330. 4 hits.
InterProiIPR006536. HnRNP-L/PTB.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 2 hits.
[Graphical view]
SMARTiSM00360. RRM. 3 hits.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 3 hits.
TIGRFAMsiTIGR01649. hnRNP-L_PTB. 1 hit.
PROSITEiPS50102. RRM. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHNRLL_HUMAN
AccessioniPrimary (citable) accession number: Q8WVV9
Secondary accession number(s): Q53T80
, Q5JB51, Q5JB52, Q659B9, Q8IVH5, Q8IVH6, Q96HR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: March 1, 2002
Last modified: November 2, 2016
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.