Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C7orf43

Gene

C7orf43

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C7orf43
Gene namesi
Name:C7orf43
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:25604. C7orf43.

Subcellular locationi

GO - Cellular componenti

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000146826.
PharmGKBiPA147358601.

Polymorphism and mutation databases

BioMutaiC7orf43.
DMDMi74730883.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002803441 – 580Uncharacterized protein C7orf43Add BLAST580

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei491PhosphoserineCombined sources1
Modified residuei517PhosphoserineCombined sources1
Modified residuei541PhosphothreonineCombined sources1
Modified residuei546PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8WVR3.
MaxQBiQ8WVR3.
PaxDbiQ8WVR3.
PeptideAtlasiQ8WVR3.
PRIDEiQ8WVR3.

PTM databases

iPTMnetiQ8WVR3.
PhosphoSitePlusiQ8WVR3.

Expressioni

Gene expression databases

BgeeiENSG00000146826.
CleanExiHS_C7orf43.
ExpressionAtlasiQ8WVR3. baseline and differential.
GenevisibleiQ8WVR3. HS.

Organism-specific databases

HPAiHPA019359.
HPA029463.
HPA029464.

Interactioni

Protein-protein interaction databases

BioGridi120552. 17 interactors.
IntActiQ8WVR3. 8 interactors.
MINTiMINT-1384126.
STRINGi9606.ENSP00000324741.

Structurei

3D structure databases

ProteinModelPortaliQ8WVR3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi54 – 134Gly-richAdd BLAST81

Phylogenomic databases

eggNOGiENOG410IH6D. Eukaryota.
ENOG4110E8Q. LUCA.
GeneTreeiENSGT00390000014725.
HOGENOMiHOG000065684.
HOVERGENiHBG081127.
InParanoidiQ8WVR3.
OMAiHYRLPSI.
OrthoDBiEOG091G04ME.
PhylomeDBiQ8WVR3.
TreeFamiTF331500.

Family and domain databases

InterProiView protein in InterPro
IPR031626. DUF4707.
PfamiView protein in Pfam
PF15806. DUF4707. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WVR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESQCDYSMY FPAVPLPPRA ELAGDPGRYR ALPRRNHLYL GETVRFLLVL
60 70 80 90 100
RCRGGAGSGT GGGPGLGSRG AWAELATALA ALASVSAGGG MPGGGGAGDQ
110 120 130 140 150
DSEPPGGGDP GGGGLFRGCS PLLTHGPGPA TSGGATTLPV EEPIVSTDEV
160 170 180 190 200
IFPLTVSLDR LPPGTPKAKI VVTVWKREIE APEVRDQGYL RLLQTRSPGE
210 220 230 240 250
TFRGEQSAFK AQVSTLLTLL PPPVLRCRQF TVAGKHLTVL KVLNSSSQEE
260 270 280 290 300
ISIWDIRILP NFNASYLPVM PDGSVLLVDN VCHQSGEVSM GSFCRLPGTS
310 320 330 340 350
GCFPCPLNAL EEHNFLFQLR GGEQPPPGAK EGLEVPLIAV VQWSTPKLPF
360 370 380 390 400
TQSIYTHYRL PSVRLDRPCF VMTASCKSPV RTYERFTVTY TLLNNLQDFL
410 420 430 440 450
AVRLVWTPEH AQAGKQLCEE ERRAMQAALD SVVCHTPLNN LGFSRKGSAL
460 470 480 490 500
TFSVAFQALR TGLFELSQHM KLKLQFTASV SHPPPEARPL SRKSSPSSPA
510 520 530 540 550
VRDLVERHQA SLGRSQSFSH QQPSRSHLMR SGSVMERRAI TPPVASPVGR
560 570 580
PLYLPPDKAV LSLDKIAKRE CKVLVVEPVK
Length:580
Mass (Da):62,597
Last modified:October 1, 2002 - v2
Checksum:iEF0E23FEFB98D328
GO
Isoform 2 (identifier: Q8WVR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-378: Missing.
     379-413: PVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQA → MHRLSGFENQMRLCWRRPCGNEERCSVCWSLFLPP
     466-468: Missing.

Note: No experimental confirmation available.
Show »
Length:199
Mass (Da):22,280
Checksum:i74E4AF44E424E80A
GO
Isoform 3 (identifier: Q8WVR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-374: Missing.
     375-413: SCKSPVRTYE...LVWTPEHAQA → MHRLFTPQSG...SVCWSLFLPP

Note: No experimental confirmation available.
Show »
Length:206
Mass (Da):23,082
Checksum:i574358441EF4AD89
GO

Sequence cautioni

The sequence CAB66490 differs from that shown. Reason: Frameshift at position 539.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti497S → R in CAB66490 (PubMed:11230166).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050817295R → H. Corresponds to variant dbSNP:rs2293477Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0236331 – 378Missing in isoform 2. 1 PublicationAdd BLAST378
Alternative sequenceiVSP_0236341 – 374Missing in isoform 3. 1 PublicationAdd BLAST374
Alternative sequenceiVSP_023635375 – 413SCKSP…EHAQA → MHRLFTPQSGFENQMRLCWR RPCGNEERCSVCWSLFLPP in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_023636379 – 413PVRTY…EHAQA → MHRLSGFENQMRLCWRRPCG NEERCSVCWSLFLPP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_023637466 – 468Missing in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136555 mRNA. Translation: CAB66490.1. Frameshift.
AK001787 mRNA. Translation: BAA91911.1.
CH236956 Genomic DNA. Translation: EAL23848.1.
CH471091 Genomic DNA. Translation: EAW76580.1.
CH471091 Genomic DNA. Translation: EAW76582.1.
BC002749 mRNA. Translation: AAH02749.2.
BC015722 mRNA. Translation: AAH15722.2.
CCDSiCCDS5687.1. [Q8WVR3-1]
RefSeqiNP_060745.3. NM_018275.4. [Q8WVR3-1]
UniGeneiHs.533139.

Genome annotation databases

EnsembliENST00000316937; ENSP00000324741; ENSG00000146826. [Q8WVR3-1]
GeneIDi55262.
KEGGihsa:55262.
UCSCiuc003utr.4. human. [Q8WVR3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCG043_HUMAN
AccessioniPrimary (citable) accession number: Q8WVR3
Secondary accession number(s): A4D2A9
, D6W5U4, Q9BQJ1, Q9BUB6, Q9NV47
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: October 1, 2002
Last modified: August 30, 2017
This is version 105 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations