Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C7orf43

Gene

C7orf43

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C7orf43
Gene namesi
Name:C7orf43
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:25604. C7orf43.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA147358601.

Polymorphism and mutation databases

BioMutaiC7orf43.
DMDMi74730883.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 580580Uncharacterized protein C7orf43PRO_0000280344Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei517 – 5171PhosphoserineCombined sources
Modified residuei541 – 5411PhosphothreonineCombined sources
Modified residuei546 – 5461PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8WVR3.
MaxQBiQ8WVR3.
PaxDbiQ8WVR3.
PRIDEiQ8WVR3.

PTM databases

iPTMnetiQ8WVR3.
PhosphoSiteiQ8WVR3.

Expressioni

Gene expression databases

BgeeiQ8WVR3.
CleanExiHS_C7orf43.
ExpressionAtlasiQ8WVR3. baseline and differential.
GenevisibleiQ8WVR3. HS.

Organism-specific databases

HPAiHPA019359.
HPA029463.
HPA029464.

Interactioni

Protein-protein interaction databases

BioGridi120552. 14 interactions.
IntActiQ8WVR3. 2 interactions.
MINTiMINT-1384126.
STRINGi9606.ENSP00000324741.

Structurei

3D structure databases

ProteinModelPortaliQ8WVR3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi54 – 13481Gly-richAdd
BLAST

Phylogenomic databases

eggNOGiENOG410IH6D. Eukaryota.
ENOG4110E8Q. LUCA.
GeneTreeiENSGT00390000014725.
HOGENOMiHOG000065684.
HOVERGENiHBG081127.
InParanoidiQ8WVR3.
OMAiFPCPLSA.
OrthoDBiEOG78WKRF.
PhylomeDBiQ8WVR3.
TreeFamiTF331500.

Family and domain databases

InterProiIPR031626. DUF4707.
[Graphical view]
PfamiPF15806. DUF4707. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WVR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESQCDYSMY FPAVPLPPRA ELAGDPGRYR ALPRRNHLYL GETVRFLLVL
60 70 80 90 100
RCRGGAGSGT GGGPGLGSRG AWAELATALA ALASVSAGGG MPGGGGAGDQ
110 120 130 140 150
DSEPPGGGDP GGGGLFRGCS PLLTHGPGPA TSGGATTLPV EEPIVSTDEV
160 170 180 190 200
IFPLTVSLDR LPPGTPKAKI VVTVWKREIE APEVRDQGYL RLLQTRSPGE
210 220 230 240 250
TFRGEQSAFK AQVSTLLTLL PPPVLRCRQF TVAGKHLTVL KVLNSSSQEE
260 270 280 290 300
ISIWDIRILP NFNASYLPVM PDGSVLLVDN VCHQSGEVSM GSFCRLPGTS
310 320 330 340 350
GCFPCPLNAL EEHNFLFQLR GGEQPPPGAK EGLEVPLIAV VQWSTPKLPF
360 370 380 390 400
TQSIYTHYRL PSVRLDRPCF VMTASCKSPV RTYERFTVTY TLLNNLQDFL
410 420 430 440 450
AVRLVWTPEH AQAGKQLCEE ERRAMQAALD SVVCHTPLNN LGFSRKGSAL
460 470 480 490 500
TFSVAFQALR TGLFELSQHM KLKLQFTASV SHPPPEARPL SRKSSPSSPA
510 520 530 540 550
VRDLVERHQA SLGRSQSFSH QQPSRSHLMR SGSVMERRAI TPPVASPVGR
560 570 580
PLYLPPDKAV LSLDKIAKRE CKVLVVEPVK
Length:580
Mass (Da):62,597
Last modified:October 1, 2002 - v2
Checksum:iEF0E23FEFB98D328
GO
Isoform 2 (identifier: Q8WVR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-378: Missing.
     379-413: PVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQA → MHRLSGFENQMRLCWRRPCGNEERCSVCWSLFLPP
     466-468: Missing.

Note: No experimental confirmation available.
Show »
Length:199
Mass (Da):22,280
Checksum:i74E4AF44E424E80A
GO
Isoform 3 (identifier: Q8WVR3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-374: Missing.
     375-413: SCKSPVRTYE...LVWTPEHAQA → MHRLFTPQSG...SVCWSLFLPP

Note: No experimental confirmation available.
Show »
Length:206
Mass (Da):23,082
Checksum:i574358441EF4AD89
GO

Sequence cautioni

The sequence CAB66490.1 differs from that shown. Reason: Frameshift at position 539. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti497 – 4971S → R in CAB66490 (PubMed:11230166).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti295 – 2951R → H.
Corresponds to variant rs2293477 [ dbSNP | Ensembl ].
VAR_050817

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 378378Missing in isoform 2. 1 PublicationVSP_023633Add
BLAST
Alternative sequencei1 – 374374Missing in isoform 3. 1 PublicationVSP_023634Add
BLAST
Alternative sequencei375 – 41339SCKSP…EHAQA → MHRLFTPQSGFENQMRLCWR RPCGNEERCSVCWSLFLPP in isoform 3. 1 PublicationVSP_023635Add
BLAST
Alternative sequencei379 – 41335PVRTY…EHAQA → MHRLSGFENQMRLCWRRPCG NEERCSVCWSLFLPP in isoform 2. 1 PublicationVSP_023636Add
BLAST
Alternative sequencei466 – 4683Missing in isoform 2. 1 PublicationVSP_023637

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136555 mRNA. Translation: CAB66490.1. Frameshift.
AK001787 mRNA. Translation: BAA91911.1.
CH236956 Genomic DNA. Translation: EAL23848.1.
CH471091 Genomic DNA. Translation: EAW76580.1.
CH471091 Genomic DNA. Translation: EAW76582.1.
BC002749 mRNA. Translation: AAH02749.2.
BC015722 mRNA. Translation: AAH15722.2.
CCDSiCCDS5687.1. [Q8WVR3-1]
RefSeqiNP_060745.3. NM_018275.4. [Q8WVR3-1]
UniGeneiHs.533139.

Genome annotation databases

EnsembliENST00000316937; ENSP00000324741; ENSG00000146826. [Q8WVR3-1]
GeneIDi55262.
KEGGihsa:55262.
UCSCiuc003utr.4. human. [Q8WVR3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136555 mRNA. Translation: CAB66490.1. Frameshift.
AK001787 mRNA. Translation: BAA91911.1.
CH236956 Genomic DNA. Translation: EAL23848.1.
CH471091 Genomic DNA. Translation: EAW76580.1.
CH471091 Genomic DNA. Translation: EAW76582.1.
BC002749 mRNA. Translation: AAH02749.2.
BC015722 mRNA. Translation: AAH15722.2.
CCDSiCCDS5687.1. [Q8WVR3-1]
RefSeqiNP_060745.3. NM_018275.4. [Q8WVR3-1]
UniGeneiHs.533139.

3D structure databases

ProteinModelPortaliQ8WVR3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120552. 14 interactions.
IntActiQ8WVR3. 2 interactions.
MINTiMINT-1384126.
STRINGi9606.ENSP00000324741.

PTM databases

iPTMnetiQ8WVR3.
PhosphoSiteiQ8WVR3.

Polymorphism and mutation databases

BioMutaiC7orf43.
DMDMi74730883.

Proteomic databases

EPDiQ8WVR3.
MaxQBiQ8WVR3.
PaxDbiQ8WVR3.
PRIDEiQ8WVR3.

Protocols and materials databases

DNASUi55262.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316937; ENSP00000324741; ENSG00000146826. [Q8WVR3-1]
GeneIDi55262.
KEGGihsa:55262.
UCSCiuc003utr.4. human. [Q8WVR3-1]

Organism-specific databases

CTDi55262.
GeneCardsiC7orf43.
H-InvDBHIX0006912.
HGNCiHGNC:25604. C7orf43.
HPAiHPA019359.
HPA029463.
HPA029464.
neXtProtiNX_Q8WVR3.
PharmGKBiPA147358601.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IH6D. Eukaryota.
ENOG4110E8Q. LUCA.
GeneTreeiENSGT00390000014725.
HOGENOMiHOG000065684.
HOVERGENiHBG081127.
InParanoidiQ8WVR3.
OMAiFPCPLSA.
OrthoDBiEOG78WKRF.
PhylomeDBiQ8WVR3.
TreeFamiTF331500.

Miscellaneous databases

GeneWikiiC7orf43.
GenomeRNAii55262.
PROiQ8WVR3.

Gene expression databases

BgeeiQ8WVR3.
CleanExiHS_C7orf43.
ExpressionAtlasiQ8WVR3. baseline and differential.
GenevisibleiQ8WVR3. HS.

Family and domain databases

InterProiIPR031626. DUF4707.
[Graphical view]
PfamiPF15806. DUF4707. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Amygdala.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Ovarian carcinoma.
  3. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin and Uterus.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-517; THR-541 AND SER-546, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiCG043_HUMAN
AccessioniPrimary (citable) accession number: Q8WVR3
Secondary accession number(s): A4D2A9
, D6W5U4, Q9BQJ1, Q9BUB6, Q9NV47
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: October 1, 2002
Last modified: June 8, 2016
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.