Q8WUW1 (BRK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein BRICK1 Short name=BRK1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 75 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. Ref.7 |
| Subunit structure | Homotrimer when in free form. Directly interacts with WASF2. Component of the WAVE1 complex composed of ABI2, CYFIP1 or CYFIP2, BRK1, NCKAP1 and WASF1/WAVE1. Within the complex, a heterdimer containing NCKAP1 and CYFIP1 interacts with a heterotrimer formed by WAVE1, ABI2 and BRK1. Ref.6 Ref.7 Ref.11 |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. |
| Sequence similarities | Belongs to the BRK1 family. |
| Sequence caution | The sequence AAF28978.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-KW cytoskeletonInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WUW1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WUW1-2) The sequence of this isoform differs from the canonical sequence as follows: 75-75: T → TRTVPCCCWEVALHNTGHMGKAPAAFSSFLSP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||||
| Chain | 2 – 75 | 74 | Protein BRICK1 | PRO_0000283646 | |||||||
Regions | |||||||||||
| Coiled coil | 41 – 72 | 32 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.8 | ||||||||
| Modified residue | 63 | 1 | Phosphotyrosine Ref.9 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 75 | 1 | T → TRTVPCCCWEVALHNTGHMG KAPAAFSSFLSP in isoform 2. | VSP_024350 | |||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 11 – 68 | 58 | |||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Xu Q., Duan R., Huo Y., Fan B., Zhang K., Wu D. Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fetal brain and Lung. |
| [2] | "Human partial CDS from CD34+ stem cells." Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Umbilical cord blood. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hippocampus. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Lymph. |
| [6] | "Purification and architecture of the ubiquitous Wave complex." Gautreau A., Ho H.-Y., Li J., Steen H., Gygi S.P., Kirschner M.W. Proc. Natl. Acad. Sci. U.S.A. 101:4379-4383(2004) [PubMed: 15070726] [Abstract] Cited for: INTERACTION WITH WASF2. |
| [7] | "Free Brick1 is a trimeric precursor in the assembly of a functional wave complex." Derivery E., Fink J., Martin D., Houdusse A., Piel M., Stradal T.E., Louvard D., Gautreau A. PLoS ONE 3:E2462-E2462(2008) [PubMed: 18560548] [Abstract] Cited for: FUNCTION, SUBUNIT. |
| [8] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [9] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-63, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Structure and control of the actin regulatory WAVE complex." Chen Z., Borek D., Padrick S.B., Gomez T.S., Metlagel Z., Ismail A.M., Umetani J., Billadeau D.D., Otwinowski Z., Rosen M.K. Nature 468:533-538(2010) [PubMed: 21107423] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.29 ANGSTROMS) OF WAVE1 COMPLEX, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY148219 mRNA. Translation: AAN60161.1. AY148220 mRNA. Translation: AAN60162.1. AF161418 mRNA. Translation: AAF28978.1. Different initiation. AK312155 mRNA. Translation: BAG35089.1. CH471055 Genomic DNA. Translation: EAW64061.1. BC001067 mRNA. Translation: AAH01067.1. BC007929 mRNA. Translation: AAH07929.1. BC019303 mRNA. Translation: AAH19303.1. | ||||||||||||
| IPI | IPI00844425. IPI01010967. | ||||||||||||
| RefSeq | NP_060932.2. NM_018462.4. | ||||||||||||
| UniGene | Hs.649307. Hs.707283. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8WUW1. | ||||||||||||
| SMR | Q8WUW1. Positions 10-73. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-41554N. | ||||||||||||
| IntAct | Q8WUW1. 3 interactions. | ||||||||||||
| MINT | MINT-244852. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8WUW1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74730773. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q8WUW1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| GeneID | 55845. | ||||||||||||
| KEGG | hsa:55845. | ||||||||||||
| UCSC | uc003bvb.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 55845. | ||||||||||||
| GeneCards | GC03P010162. | ||||||||||||
| HGNC | HGNC:23057. BRK1. | ||||||||||||
| MIM | 611183. gene. | ||||||||||||
| neXtProt | NX_Q8WUW1. | ||||||||||||
| PharmGKB | PA134866423. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG21709. | ||||||||||||
| HOVERGEN | HBG107432. | ||||||||||||
| InParanoid | Q8WUW1. | ||||||||||||
| OrthoDB | EOG4CG09X. | ||||||||||||
| PhylomeDB | Q8WUW1. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | Q8WUW1. | ||||||||||||
| CleanEx | HS_C3orf10. | ||||||||||||
| Genevestigator | Q8WUW1. | ||||||||||||
Family and domain databases | |||||||||||||
| KO | K05752. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 61091. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | BRK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WUW1 Secondary accession number(s): B2R5E2, Q9P082 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with