Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BRICK1

Gene

BRK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex.1 Publication

GO - Molecular functioni

  • protein complex binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-4420097. VEGFA-VEGFR2 Pathway.
R-HSA-5663213. RHO GTPases Activate WASPs and WAVEs.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BRICK1
Short name:
BRK1
Gene namesi
Name:BRK1
Synonyms:C3orf10
ORF Names:HSPC300, MDS027
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:23057. BRK1.

Subcellular locationi

GO - Cellular componenti

  • cytoskeleton Source: UniProtKB-SubCell
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • lamellipodium Source: UniProtKB
  • SCAR complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134866423.

Polymorphism and mutation databases

BioMutaiBRK1.
DMDMi74730773.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedCombined sources
Chaini2 – 7574Protein BRICK1PRO_0000283646Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineCombined sources

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ8WUW1.
MaxQBiQ8WUW1.
PaxDbiQ8WUW1.
PeptideAtlasiQ8WUW1.
PRIDEiQ8WUW1.
TopDownProteomicsiQ8WUW1-1. [Q8WUW1-1]
Q8WUW1-2. [Q8WUW1-2]

PTM databases

iPTMnetiQ8WUW1.
PhosphoSiteiQ8WUW1.

Expressioni

Gene expression databases

BgeeiENSG00000254999.
CleanExiHS_C3orf10.
GenevisibleiQ8WUW1. HS.

Interactioni

Subunit structurei

Homotrimer when in free form. Directly interacts with WASF2. Component of the WAVE1 complex composed of ABI2, CYFIP1 or CYFIP2, BRK1, NCKAP1 and WASF1/WAVE1. Within the complex, a heterodimer containing NCKAP1 and CYFIP1 interacts with a heterotrimer formed by WAVE1, ABI2 and BRK1.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
DTNBP1Q96EV83EBI-2837444,EBI-465804

GO - Molecular functioni

  • protein complex binding Source: UniProtKB

Protein-protein interaction databases

BioGridi120947. 20 interactions.
DIPiDIP-41554N.
IntActiQ8WUW1. 28 interactions.
MINTiMINT-244852.
STRINGi9606.ENSP00000432472.

Structurei

Secondary structure

1
75
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi11 – 6858Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3P8CX-ray2.29E1-75[»]
4N78X-ray2.43E1-75[»]
ProteinModelPortaliQ8WUW1.
SMRiQ8WUW1. Positions 10-73.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WUW1.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili41 – 7232Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the BRK1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410J0X8. Eukaryota.
ENOG4111UHX. LUCA.
GeneTreeiENSGT00390000011082.
HOVERGENiHBG107432.
InParanoidiQ8WUW1.
KOiK05752.
OMAiEACVTQG.
OrthoDBiEOG091G172W.
PhylomeDBiQ8WUW1.
TreeFamiTF324876.

Family and domain databases

InterProiIPR033378. BRICK1.
[Graphical view]
PANTHERiPTHR33668. PTHR33668. 1 hit.
ProDomiPD593487. PD593487. 1 hit.
[Graphical view] [Entries sharing at least one domain]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WUW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGQEDPVQR EIHQDWANRE YIEIITSSIK KIADFLNSFD MSCRSRLATL
60 70
NEKLTALERR IEYIEARVTK GETLT
Length:75
Mass (Da):8,745
Last modified:March 1, 2002 - v1
Checksum:i637B5461A2D96587
GO
Isoform 2 (identifier: Q8WUW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     75-75: T → TRTVPCCCWEVALHNTGHMGKAPAAFSSFLSP

Note: No experimental confirmation available.
Show »
Length:106
Mass (Da):12,046
Checksum:i908E7A141251DFE5
GO

Sequence cautioni

The sequence AAF28978 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei75 – 751T → TRTVPCCCWEVALHNTGHMG KAPAAFSSFLSP in isoform 2. 1 PublicationVSP_024350

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY148219 mRNA. Translation: AAN60161.1.
AY148220 mRNA. Translation: AAN60162.1.
AF161418 mRNA. Translation: AAF28978.1. Different initiation.
AK312155 mRNA. Translation: BAG35089.1.
CH471055 Genomic DNA. Translation: EAW64061.1.
BC001067 mRNA. Translation: AAH01067.1.
BC007929 mRNA. Translation: AAH07929.1.
BC019303 mRNA. Translation: AAH19303.1.
CCDSiCCDS54553.1. [Q8WUW1-1]
RefSeqiNP_060932.2. NM_018462.4. [Q8WUW1-1]
UniGeneiHs.649307.

Genome annotation databases

EnsembliENST00000530758; ENSP00000432472; ENSG00000254999. [Q8WUW1-1]
GeneIDi55845.
KEGGihsa:55845.
UCSCiuc003bvb.4. human. [Q8WUW1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY148219 mRNA. Translation: AAN60161.1.
AY148220 mRNA. Translation: AAN60162.1.
AF161418 mRNA. Translation: AAF28978.1. Different initiation.
AK312155 mRNA. Translation: BAG35089.1.
CH471055 Genomic DNA. Translation: EAW64061.1.
BC001067 mRNA. Translation: AAH01067.1.
BC007929 mRNA. Translation: AAH07929.1.
BC019303 mRNA. Translation: AAH19303.1.
CCDSiCCDS54553.1. [Q8WUW1-1]
RefSeqiNP_060932.2. NM_018462.4. [Q8WUW1-1]
UniGeneiHs.649307.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3P8CX-ray2.29E1-75[»]
4N78X-ray2.43E1-75[»]
ProteinModelPortaliQ8WUW1.
SMRiQ8WUW1. Positions 10-73.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120947. 20 interactions.
DIPiDIP-41554N.
IntActiQ8WUW1. 28 interactions.
MINTiMINT-244852.
STRINGi9606.ENSP00000432472.

PTM databases

iPTMnetiQ8WUW1.
PhosphoSiteiQ8WUW1.

Polymorphism and mutation databases

BioMutaiBRK1.
DMDMi74730773.

Proteomic databases

EPDiQ8WUW1.
MaxQBiQ8WUW1.
PaxDbiQ8WUW1.
PeptideAtlasiQ8WUW1.
PRIDEiQ8WUW1.
TopDownProteomicsiQ8WUW1-1. [Q8WUW1-1]
Q8WUW1-2. [Q8WUW1-2]

Protocols and materials databases

DNASUi55845.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000530758; ENSP00000432472; ENSG00000254999. [Q8WUW1-1]
GeneIDi55845.
KEGGihsa:55845.
UCSCiuc003bvb.4. human. [Q8WUW1-1]

Organism-specific databases

CTDi55845.
GeneCardsiBRK1.
HGNCiHGNC:23057. BRK1.
MIMi611183. gene.
neXtProtiNX_Q8WUW1.
PharmGKBiPA134866423.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J0X8. Eukaryota.
ENOG4111UHX. LUCA.
GeneTreeiENSGT00390000011082.
HOVERGENiHBG107432.
InParanoidiQ8WUW1.
KOiK05752.
OMAiEACVTQG.
OrthoDBiEOG091G172W.
PhylomeDBiQ8WUW1.
TreeFamiTF324876.

Enzyme and pathway databases

ReactomeiR-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-4420097. VEGFA-VEGFR2 Pathway.
R-HSA-5663213. RHO GTPases Activate WASPs and WAVEs.

Miscellaneous databases

ChiTaRSiBRK1. human.
EvolutionaryTraceiQ8WUW1.
GeneWikiiC3orf10.
GenomeRNAii55845.
PROiQ8WUW1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000254999.
CleanExiHS_C3orf10.
GenevisibleiQ8WUW1. HS.

Family and domain databases

InterProiIPR033378. BRICK1.
[Graphical view]
PANTHERiPTHR33668. PTHR33668. 1 hit.
ProDomiPD593487. PD593487. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetiSearch...

Entry informationi

Entry nameiBRK1_HUMAN
AccessioniPrimary (citable) accession number: Q8WUW1
Secondary accession number(s): B2R5E2, Q9P082
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: March 1, 2002
Last modified: September 7, 2016
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.