Reviewed,
UniProtKB/Swiss-Prot Q8WUW1 (BRK1_HUMAN)
Last modified
June 16, 2009.
Version 50.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Probable protein BRICK1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 75 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex By similarity. |
| Subunit structure | Directly interacts with WASF2. Ref.4 |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. |
| Involvement in disease | Deletion of C3orf10 prevents the development of clear cell renal carcinoma in Von Hippel-Lindau patients. Ref.6 |
| Sequence similarities | Belongs to the BRK1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell cytoskeletonInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WUW1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WUW1-2) The sequence of this isoform differs from the canonical sequence as follows: 75-75: T → TRTVPCCCWEVALHNTGHMGKAPAAFSSFLSP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
Sequences
References
| « Hide 'large scale' references | |
| [1] | Xu Q., Duan R., Huo Y., Fan B., Zhang K., Wu D. Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fetal brain and Lung. |
| [2] | "Human partial CDS from CD34+ stem cells." Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Umbilical cord blood. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Lymph. |
| [4] | "Purification and architecture of the ubiquitous Wave complex." Gautreau A., Ho H.-Y., Li J., Steen H., Gygi S.P., Kirschner M.W. Proc. Natl. Acad. Sci. U.S.A. 101:4379-4383(2004) [PubMed: 15070726] [Abstract] Cited for: INTERACTION WITH WASF2. |
| [5] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [6] | "Loss of the actin regulator HSPC300 results in clear cell renal cell carcinoma protection in Von Hippel-Lindau patients." Cascon A., Escobar B., Montero-Conde C., Rodriguez-Antona C., Ruiz-Llorente S., Osorio A., Mercadillo F., Leton R., Campos J.M., Garcia-Sagredo J.M., Benitez J., Malumbres M., Robledo M. Hum. Mutat. 28:613-621(2007) [PubMed: 17311301] [Abstract] Cited for: DISEASE. |
Cross-references
Sequence databases | |
|---|---|
| AY148219 mRNA. Translation: AAN60161.1. AY148220 mRNA. Translation: AAN60162.1. AF161418 mRNA. Translation: AAF28978.1. Different initiation. BC001067 mRNA. Translation: AAH01067.1. BC007929 mRNA. Translation: AAH07929.1. BC019303 mRNA. Translation: AAH19303.1. | |
| IPI | IPI00000296. IPI00844425. |
| RefSeq | NP_060932.2. |
| UniGene | Hs.649307 Hs.707283 |
3D structure databases | |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q8WUW1. |
Genome annotation databases | |
| Ensembl | ENSG00000219870. Homo sapiens. [Contig view] |
| GeneID | 55845. |
| KEGG | hsa:55845. |
Organism-specific databases | |
| GeneCards | GC03P010134. |
| HGNC | HGNC:23057. C3orf10. |
| MIM | 611183. gene. |
| PharmGKB | PA134866423. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8WUW1. |
Gene expression databases | |
| Bgee | Q8WUW1. |
| CleanEx | HS_C3orf10. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 61091. |
| SOURCE | Search... |
Entry information
| Entry name | BRK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WUW1 Secondary accession number(s): Q9P082 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


