Q8WUI4 (HDAC7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone deacetylase 7 Short name=HD7 EC=3.5.1.98 Alternative name(s): Histone deacetylase 7A Short name=HD7a | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 952 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer factors such as MEF2A, MEF2B and MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors By similarity. May be involved in Epstein-Barr virus (EBV) latency, possibly by repressing the viral BZLF1 gene. Ref.12 |
| Catalytic activity | Hydrolysis of an N(6)-acetyl-lysine residue of a histone to yield a deacetylated histone. |
| Subunit structure | Interacts with HDAC1, HDAC2, HDAC3, HDAC4, HDAC5, NCOR1, NCOR2, SIN3A, SIN3B, RBBP4, RBBP7, MTA1L1, SAP30 and MBD3. Interacts with the 14-3-3 protein YWHAE, MEF2A, MEF2B and MEF2C By similarity. Interacts with KAT5 and EDNRA. Interacts with KDM5B. Interacts with ZMYND15 By similarity. Interacts with PML (isoform PML-4). Ref.10 Ref.11 Ref.13 Ref.16 Ref.22 |
| Subcellular location | Nucleus. Cytoplasm. Note: In the nucleus, it associates with distinct subnuclear dot-like structures. Shuttles between the nucleus and the cytoplasm. Treatment with EDN1 results in shuttling from the nucleus to the perinuclear region. The export to cytoplasm depends on the interaction with the 14-3-3 protein YWHAE and is due to its phosphorylation. Ref.10 Ref.14 |
| Domain | The nuclear export sequence mediates the shuttling between the nucleus and the cytoplasm By similarity. |
| Post-translational modification | May be phosphorylated by CaMK1. Phosphorylated by the PKC kinases PKN1 and PKN2, impairing nuclear import. Phosphorylation at Ser-155 by MARK2, MARK3 and PRKD1 promotes interaction with 14-3-3 proteins and export from the nucleus. Phosphorylation at Ser-155 is a prerequisite for phosphorylation at Ser-181. Ref.14 Ref.15 Ref.19 |
| Miscellaneous | Its activity is inhibited by Trichostatin A (TSA), a known histone deacetylase inhibitor By similarity. |
| Sequence similarities | Belongs to the histone deacetylase family. HD type 2 subfamily. |
| Sequence caution | The sequence AAF63491.1 differs from that shown. Reason: Frameshift at position 877. The sequence BAA91474.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA91545.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB15759.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB55363.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC56929.1 differs from that shown. Reason: Intron retention. |
Ontologies
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WUI4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WUI4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-472: Missing. 473-520: LAQGGHRPLS...TPARTLPFTT → MQACVGVRGV...WVPALTLAPA | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8WUI4-3) The sequence of this isoform differs from the canonical sequence as follows: 227-263: Missing. | ||||||
| Isoform 4 (identifier: Q8WUI4-4) The sequence of this isoform differs from the canonical sequence as follows: 227-256: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q8WUI4-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MHSPGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPM | ||||||
| Isoform 6 (identifier: Q8WUI4-6) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MHSPGAGCPRPCADTPGPQPQPM | ||||||
| Isoform 7 (identifier: Q8WUI4-7) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MHSPGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPM 227-263: Missing. | ||||||
| Isoform 8 (identifier: Q8WUI4-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSDLRKRELGALFTSRGTGGVEWDGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPM 892-952: SKYWGCMQRL...LVEEEEPMNL → MGALTLSQIP...QGLTKKKWRQ | ||||||
| Isoform 9 (identifier: Q8WUI4-9) The sequence of this isoform differs from the canonical sequence as follows: 1-527: Missing. | ||||||
| Isoform 10 (identifier: Q8WUI4-10) The sequence of this isoform differs from the canonical sequence as follows: 1-338: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 952 | 952 | Histone deacetylase 7 | PRO_0000114705 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 268 | 268 | Transcription repression 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 98 | 98 | Interaction with MEF2C By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 49 – 149 | 101 | Interaction with MEF2A By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 218 – 546 | 329 | Transcription repression 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 518 – 865 | 348 | Histone deacetylase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 877 – 952 | 76 | Interaction with SIN3A By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 918 – 952 | 35 | Nuclear export signal By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 197 – 203 | 7 | Poly-Ser | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 368 – 373 | 6 | Poly-Pro | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 670 | 1 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 533 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 535 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 541 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 618 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 843 | 1 | Contributes to catalysis | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 109 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 155 | 1 | Phosphoserine; by MARK2, MARK3 and PKD/PRKD1 Probable | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 181 | 1 | Phosphoserine; by PKD/PRKD2 Ref.14 Ref.15 Ref.20 Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 283 | 1 | Phosphoserine Ref.17 Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 286 | 1 | Phosphothreonine Ref.17 Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 358 | 1 | Phosphoserine; by PKD/PRKD1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 486 | 1 | Phosphoserine Ref.17 Ref.18 Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 527 | 527 | Missing in isoform 9. | VSP_038102 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 472 | 472 | Missing in isoform 2. | VSP_007429 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 338 | 338 | Missing in isoform 10. | VSP_038103 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MHSPGADGTQVSPGAHYCSP TGAGCPRPCADTPGPQPQPM in isoform 5 and isoform 7. | VSP_038104 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MHSPGAGCPRPCADTPGPQP QPM in isoform 6. | VSP_038105 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MSDLRKRELGALFTSRGTGG VEWDGTQVSPGAHYCSPTGA GCPRPCADTPGPQPQPM in isoform 8. | VSP_038106 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 227 – 263 | 37 | Missing in isoform 3 and isoform 7. | VSP_008772 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 227 – 256 | 30 | Missing in isoform 4. | VSP_007430 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 473 – 520 | 48 | LAQGG…LPFTT → MQACVGVRGVYPPGSMWVPA VAVLACSLQPRPWGVRTPWV PALTLAPA in isoform 2. | VSP_007431 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 892 – 952 | 61 | SKYWG…EPMNL → MGALTLSQIPGHGSSQQQAG GAFSRPGHPCRAAVVMVNTG AACSAWPPVQTPGCLECQGL TKKKWRQ in isoform 8. | VSP_038107 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 43 | 1 | V → M in a breast cancer sample; somatic mutation. Ref.24 | VAR_036043 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 150 | 1 | L → A: Abolishes phosphorylation at S-155. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 155 | 1 | S → A: Abolishes nuclear export; when associated with A-181; A-358 and A-486. Abolishes phosphorylation by MARK2 and MARK3, interaction with 14-3-3 and localization to the cytoplasm. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 181 | 1 | S → A: Abolishes nuclear export; when associated with A-155; A-358 and A-486. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 358 | 1 | S → A: Abolishes nuclear export; when associated with A-192; A-1118 and A-486. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 486 | 1 | S → A: Abolishes nuclear export; when associated with A-192; A-1118 and A-358. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 843 | 1 | H → A: Enhanced deacetylase activity. Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 843 | 1 | H → F: Enhanced deacetylase activity. Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 843 | 1 | H → Y: 6000 fold increase in deacetylase activity. Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 50 | 1 | M → T in BAG64517. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 225 – 264 | 40 | Missing in AAF63491. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 276 | 1 | P → L in BAA91545. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 561 | 1 | R → L in BAA91545. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 614 | 1 | V → E in AAF63491. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 644 | 1 | S → R in BAB15759. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 665 | 1 | R → W in BAA91474. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 700 | 1 | K → KASK in AAF63491. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 750 | 1 | G → S in BAA91545. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 777 | 1 | A → T in BAB55363. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 825 | 1 | Q → H in BAA91474. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 520 – 523 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 526 – 530 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 538 – 540 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 546 – 557 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 561 – 563 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 564 – 567 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 574 – 577 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 578 – 580 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 583 – 590 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 601 – 609 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 621 – 626 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 631 – 633 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 634 – 653 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 656 – 662 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 680 – 682 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 684 – 695 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 701 – 705 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 707 – 709 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 712 – 718 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 724 – 731 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 733 – 736 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 750 – 752 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 756 – 761 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 765 – 767 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 771 – 780 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 782 – 789 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 792 – 798 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 808 – 810 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 817 – 827 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 831 – 833 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 835 – 839 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 845 – 860 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 866 – 868 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 871 – 873 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 878 – 891 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 892 – 894 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 896 – 898 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel class II HDAC is associated with the transcriptional homeodomain repressor CCAAT displacement protein." Li S., Fischle W., Verdin E., Walsh M.J. Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Cervix carcinoma. |
| [2] | "Genomic organization of the human histone deacetylase 7 gene." Petrie K., Zelent A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 5). |
| [3] | "Homo sapiens histone deacetylase 7A (HDAC7A), transcript variant 3." Zhi Y., Su E.W. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6; 8 AND 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 220-952 (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 651-952. Tissue: Embryo, Mammary gland, Placenta, Spleen, Teratocarcinoma and Thymus. |
| [6] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 242-952 (ISOFORM 1). Tissue: B-cell, Colon and PNS. |
| [9] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-952 (ISOFORM 1). Tissue: Uterus. |
| [10] | "Tip60 and HDAC7 interact with the endothelin receptor a and may be involved in downstream signaling." Lee H.-J., Chun M., Kandror K.V. J. Biol. Chem. 276:16597-16600(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH EDNRA. |
| [11] | "Human HDAC7 histone deacetylase activity is associated with HDAC3 in vivo." Fischle W., Dequiedt F., Fillion M., Hendzel M.J., Voelter W., Verdin E. J. Biol. Chem. 276:35826-35835(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HDAC3. |
| [12] | "Signal transduction and transcription factor modification during reactivation of Epstein-Barr virus from latency." Bryant H., Farrell P.J. J. Virol. 76:10290-10298(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Tip60 is a co-repressor for STAT3." Xiao H., Chung J., Kao H.-Y., Yang Y.-C. J. Biol. Chem. 278:11197-11204(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KAT5. |
| [14] | "New role for hPar-1 kinases EMK and C-TAK1 in regulating localization and activity of class IIa histone deacetylases." Dequiedt F., Martin M., Von Blume J., Vertommen D., Lecomte E., Mari N., Heinen M.F., Bachmann M., Twizere J.C., Huang M.C., Rider M.H., Piwnica-Worms H., Seufferlein T., Kettmann R. Mol. Cell. Biol. 26:7086-7102(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-155 AND SER-181, MUTAGENESIS OF LEU-150; SER-155; SER-181; SER-358 AND SER-486. |
| [15] | "Phosphorylation at Ser244 by CK1 determines nuclear localization and substrate targeting of PKD2." von Blume J., Knippschild U., Dequiedt F., Giamas G., Beck A., Auer A., Van Lint J., Adler G., Seufferlein T. EMBO J. 26:4619-4633(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-181. |
| [16] | "Breast cancer associated transcriptional repressor PLU-1/JARID1B interacts directly with histone deacetylases." Barrett A., Santangelo S., Tan K., Catchpole S., Roberts K., Spencer-Dene B., Hall D., Scibetta A., Burchell J., Verdin E., Freemont P., Taylor-Papadimitriou J. Int. J. Cancer 121:265-275(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KDM5B. |
| [17] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-109; SER-283; THR-286 AND SER-486, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-486, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [19] | "Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases." Harrison B.C., Huynh K., Lundgaard G.L., Helmke S.M., Perryman M.B., McKinsey T.A. FEBS Lett. 584:1103-1110(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION. |
| [20] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-181; SER-283 AND THR-286, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [21] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-181 AND SER-486, MASS SPECTROMETRY. |
| [22] | "Beta-catenin inhibits promyelocytic leukemia protein tumor suppressor function in colorectal cancer cells." Satow R., Shitashige M., Jigami T., Fukami K., Honda K., Kitabayashi I., Yamada T. Gastroenterology 142:572-581(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PML. |
| [23] | "Human HDAC7 harbors a class IIa histone deacetylase-specific zinc binding motif and cryptic deacetylase activity." Schuetz A., Min J., Allali-Hassani A., Schapira M., Shuen M., Loppnau P., Mazitschek R., Kwiatkowski N.P., Lewis T.A., Maglathin R.L., McLean T.H., Bochkarev A., Plotnikov A.N., Vedadi M., Arrowsmith C.H. J. Biol. Chem. 283:11355-11363(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 482-903, ZINC-BINDING SITES, MUTAGENESIS OF HIS-843. |
| [24] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-43. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF239243 mRNA. Translation: AAF63491.1. Frameshift. AY302468 mRNA. Translation: AAQ18232.1. AY321367 mRNA. Translation: AAP84704.1. BT009771 mRNA. Translation: AAP88773.1. AK001032 mRNA. Translation: BAA91474.1. Different initiation. AK001190 mRNA. Translation: BAA91545.1. Different initiation. AK024469 mRNA. Translation: BAB15759.1. Different initiation. AK027781 mRNA. Translation: BAB55363.1. Different initiation. AK122588 mRNA. Translation: BAC56929.1. Sequence problems. AK128383 mRNA. Translation: BAG54670.1. AK299292 mRNA. Translation: BAG61307.1. AK301545 mRNA. Translation: BAG63042.1. AK303481 mRNA. Translation: BAG64517.1. AC004466 Genomic DNA. No translation available. CH471111 Genomic DNA. Translation: EAW57957.1. BC006453 mRNA. Translation: AAH06453.2. BC020505 mRNA. Translation: AAH20505.2. BC064840 mRNA. Translation: AAH64840.1. AL117455 mRNA. Translation: CAB55935.1. | ||||||||||||||||||||||||
| IPI | IPI00306189. IPI00386808. IPI00743474. IPI00909569. IPI00916348. IPI00916470. IPI00916810. IPI00917034. IPI00944518. IPI00944634. | ||||||||||||||||||||||||
| PIR | T17245. | ||||||||||||||||||||||||
| RefSeq | NP_001091886.1. NM_001098416.2. NP_056216.2. NM_015401.3. | ||||||||||||||||||||||||
| UniGene | Hs.200063. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q8WUI4. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-29860N. | ||||||||||||||||||||||||
| IntAct | Q8WUI4. 1 interaction. | ||||||||||||||||||||||||
| MINT | MINT-3089050. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q8WUI4. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 30913097. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q8WUI4. | ||||||||||||||||||||||||
| PRIDE | Q8WUI4. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 51564. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000080059; ENSP00000080059; ENSG00000061273. ENST00000354334; ENSP00000351326; ENSG00000061273. ENST00000427332; ENSP00000404394; ENSG00000061273. ENST00000552960; ENSP00000448532; ENSG00000061273. | ||||||||||||||||||||||||
| GeneID | 51564. | ||||||||||||||||||||||||
| KEGG | hsa:51564. | ||||||||||||||||||||||||
| UCSC | uc001rqe.3. human. uc001rqj.4. human. uc001rqk.4. human. uc010slo.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 51564. | ||||||||||||||||||||||||
| GeneCards | GC12M048176. | ||||||||||||||||||||||||
| H-InvDB | HIX0129669. | ||||||||||||||||||||||||
| HGNC | HGNC:14067. HDAC7. | ||||||||||||||||||||||||
| HPA | HPA004775. | ||||||||||||||||||||||||
| MIM | 606542. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q8WUI4. | ||||||||||||||||||||||||
| PharmGKB | PA162390579. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG0123. | ||||||||||||||||||||||||
| HOVERGEN | HBG057100. | ||||||||||||||||||||||||
| InParanoid | Q8WUI4. | ||||||||||||||||||||||||
| KO | K11408. | ||||||||||||||||||||||||
| OrthoDB | EOG4NKBV4. | ||||||||||||||||||||||||
| PhylomeDB | Q8WUI4. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| BRENDA | 3.5.1.98. 2681. | ||||||||||||||||||||||||
| Pathway_Interaction_DB | hif1_tfpathway. HIF-1-alpha transcription factor network. ar_tf_pathway. Regulation of Androgen receptor activity. hdac_classi_pathway. Signaling events mediated by HDAC Class I. hdac_classii_pathway. Signaling events mediated by HDAC Class II. | ||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q8WUI4. | ||||||||||||||||||||||||
| Bgee | Q8WUI4. | ||||||||||||||||||||||||
| CleanEx | HS_HDAC7. | ||||||||||||||||||||||||
| Genevestigator | Q8WUI4. | ||||||||||||||||||||||||
| GermOnline | ENSG00000061273. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 3.40.800.20. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR000286. His_deacetylse. IPR023801. His_deacetylse_dom. IPR017320. Histone_deAcase_II_euk. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR10625. PTHR10625. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF00850. Hist_deacetyl. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PIRSF | PIRSF037911. HDAC_II_euk. 1 hit. | ||||||||||||||||||||||||
| PRINTS | PR01270. HDASUPER. | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | Q8WUI4. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL2716. | ||||||||||||||||||||||||
| ChiTaRS | HDAC7. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q8WUI4. | ||||||||||||||||||||||||
| GenomeRNAi | 51564. | ||||||||||||||||||||||||
| NextBio | 55370. | ||||||||||||||||||||||||
| PMAP-CutDB | Q8WUI4. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | HDAC7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WUI4 Secondary accession number(s): B3KY08 Q9UFU7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
