Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8WUH1 (CHUR_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein Churchill
Gene names
Name:CHURC1
Synonyms:C14orf52, CHCH
ORF Names:My015
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length139 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcriptional activator that mediates FGF signaling during neural development. Plays a role in the regulation of cell movement By similarity. Does not bind DNA by itself.

Sequence similarities

Belongs to the Churchill family.

Caution

It is uncertain whether Met-1 or Met-28 is the initiator. Some orthologous sequences cannot be extended. The protein analyzed in Ref.6 is derived from a construct starting at Met-28.

Mass spectrometry

Molecular mass is 13033 Da from positions 28 - 139. Determined by MALDI. The mass difference may be explained by bound zinc ions. Ref.6

Sequence caution

The sequence AAG43128.1 differs from that shown. Reason: Frameshift at positions=92 and translation N-terminally extended.

The sequence AAH20550.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAG51943.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8WUH1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8WUH1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     86-86: H → PD
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8WUH1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     86-139: HLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF → RVYHAVSVMRQSRRYYQYSP

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 139139Protein Churchill
PRO_0000089665

Sites

Metal binding291Zinc 1
Metal binding321Zinc 1
Metal binding571Zinc 1
Metal binding571Zinc 2
Metal binding601Zinc 2
Metal binding861Zinc 3
Metal binding881Zinc 2
Metal binding911Zinc 2
Metal binding931Zinc 1
Metal binding981Zinc 3
Metal binding1151Zinc 3
Metal binding1181Zinc 3

Natural variations

Alternative sequence86 – 13954HLCKN…MTLLF → RVYHAVSVMRQSRRYYQYSP in isoform 3.
VSP_046509
Alternative sequence861H → PD in isoform 2.
VSP_021021

Experimental info

Sequence conflict1 – 33Missing in AAH20550. Ref.3

Secondary structure

.................. 139
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 29, 2013. Version 2.
Checksum: 16B578B7DBC53CF9

FASTA13916,111
        10         20         30         40         50         60 
MRQPYLSSRE VSSSRKRWRT FPVDCVAMCG DCVEKEYPNR GNTCLENGSF LLNFTGCAVC 

        70         80         90        100        110        120 
SKRDFMLITN KSLKEEDGEE IVTYDHLCKN CHHVIARHEY TFSIMDEFQE YTMLCLLCGK 

       130 
AEDTISILPD DPRQMTLLF 

« Hide

Isoform 2 [UniParc].

Checksum: 01C9EA7F745A3954
Show »

FASTA14016,187
Isoform 3 [UniParc].

Checksum: F97F156E104D76D6
Show »

FASTA10512,286

References

« Hide 'large scale' references
[1]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]Mao Y.M., Xie Y., Lin Q., Li Y., Dai J.L., Ying K.
Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 11-139 (ISOFORM 2).
Tissue: Fetal brain.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 13-139 (ISOFORM 1).
Tissue: Trachea.
[6]"Embryonic neural inducing factor Churchill is not a DNA-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster."
Lee B.M., Buck-Koehntop B.A., Martinez-Yamout M.A., Dyson H.J., Wright P.E.
J. Mol. Biol. 371:1274-1289(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 29-136 IN COMPLEX WITH ZINC IONS, LACK OF DNA-BINDING, MASS SPECTROMETRY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AL135745 Genomic DNA. No translation available.
AL139022 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80884.1.
CH471061 Genomic DNA. Translation: EAW80887.1.
BC020550 mRNA. Translation: AAH20550.1. Different initiation.
AF060510 mRNA. Translation: AAG43128.1. Sequence problems.
AK057626 mRNA. Translation: BAG51943.1. Different initiation.
CCDSCCDS32101.2. [Q8WUH1-2]
CCDS55921.1. [Q8WUH1-1]
CCDS55922.1. [Q8WUH1-3]
RefSeqNP_001190992.1. NM_001204063.1. [Q8WUH1-1]
NP_001190993.1. NM_001204064.1. [Q8WUH1-3]
NP_660148.3. NM_145165.3. [Q8WUH1-2]
UniGeneHs.731537.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2JOXNMR-A29-134[»]
ProteinModelPortalQ8WUH1.
SMRQ8WUH1. Positions 29-134.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124853. 3 interactions.

Polymorphism databases

DMDM510120833.

Proteomic databases

MaxQBQ8WUH1.
PaxDbQ8WUH1.
PeptideAtlasQ8WUH1.
PRIDEQ8WUH1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000548752; ENSP00000450165; ENSG00000258289. [Q8WUH1-3]
ENST00000549115; ENSP00000448050; ENSG00000258289. [Q8WUH1-1]
ENST00000552002; ENSP00000450144; ENSG00000258289.
ENST00000607599; ENSP00000475473; ENSG00000258289. [Q8WUH1-2]
GeneID91612.
KEGGhsa:91612.
UCSCuc001xhv.3. human.
uc001xhw.2. human.

Organism-specific databases

CTD91612.
GeneCardsGC14P065383.
HGNCHGNC:20099. CHURC1.
HPACAB009260.
HPA040072.
MIM608577. gene.
neXtProtNX_Q8WUH1.
PharmGKBPA134982480.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5029.
HOGENOMHOG000246424.
HOVERGENHBG039391.
InParanoidQ8WUH1.
OMAEYTMLCM.
OrthoDBEOG7X0VJS.
TreeFamTF333004.

Gene expression databases

ArrayExpressQ8WUH1.
BgeeQ8WUH1.
CleanExHS_CHURC1.
GenevestigatorQ8WUH1.

Family and domain databases

InterProIPR009508. Transcrpt_activator_Churchill.
[Graphical view]
PfamPF06573. Churchill. 1 hit.
[Graphical view]
ProDomPD355092. Churchill. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetSearch...

Other

ChiTaRSCHURC1. human.
EvolutionaryTraceQ8WUH1.
GenomeRNAi91612.
NextBio77335.
PROQ8WUH1.
SOURCESearch...

Entry information

Entry nameCHUR_HUMAN
AccessionPrimary (citable) accession number: Q8WUH1
Secondary accession number(s): B3KQ81 expand/collapse secondary AC list , G3V1X3, G3V214, Q9H3K7
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2003
Last sequence update: May 29, 2013
Last modified: July 9, 2014
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM