Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WUH1

- CHUR_HUMAN

UniProt

Q8WUH1 - CHUR_HUMAN

Protein

Protein Churchill

Gene

CHURC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Transcriptional activator that mediates FGF signaling during neural development. Plays a role in the regulation of cell movement By similarity. Does not bind DNA by itself.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi29 – 291Zinc 1
    Metal bindingi32 – 321Zinc 1
    Metal bindingi57 – 571Zinc 1
    Metal bindingi57 – 571Zinc 2
    Metal bindingi60 – 601Zinc 2
    Metal bindingi86 – 861Zinc 3
    Metal bindingi88 – 881Zinc 2
    Metal bindingi91 – 911Zinc 2
    Metal bindingi93 – 931Zinc 1
    Metal bindingi98 – 981Zinc 3
    Metal bindingi115 – 1151Zinc 3
    Metal bindingi118 – 1181Zinc 3

    GO - Molecular functioni

    1. zinc ion binding Source: InterPro

    GO - Biological processi

    1. multicellular organismal development Source: UniProtKB-KW
    2. positive regulation of transcription, DNA-templated Source: InterPro
    3. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator, Developmental protein

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein Churchill
    Gene namesi
    Name:CHURC1
    Synonyms:C14orf52, CHCH
    ORF Names:My015
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:20099. CHURC1.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134982480.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 139139Protein ChurchillPRO_0000089665Add
    BLAST

    Proteomic databases

    MaxQBiQ8WUH1.
    PaxDbiQ8WUH1.
    PeptideAtlasiQ8WUH1.
    PRIDEiQ8WUH1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8WUH1.
    BgeeiQ8WUH1.
    CleanExiHS_CHURC1.
    GenevestigatoriQ8WUH1.

    Organism-specific databases

    HPAiCAB009260.
    HPA040072.

    Interactioni

    Protein-protein interaction databases

    BioGridi124853. 3 interactions.

    Structurei

    Secondary structure

    1
    139
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi33 – 375
    Turni51 – 533
    Beta strandi58 – 603
    Beta strandi66 – 7611
    Beta strandi79 – 8810
    Turni89 – 913
    Beta strandi94 – 10512
    Beta strandi108 – 1158
    Turni116 – 1183
    Beta strandi119 – 1268

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2JOXNMR-A29-134[»]
    ProteinModelPortaliQ8WUH1.
    SMRiQ8WUH1. Positions 29-134.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8WUH1.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the Churchill family.Curated

    Phylogenomic databases

    eggNOGiCOG5029.
    HOGENOMiHOG000246424.
    HOVERGENiHBG039391.
    InParanoidiQ8WUH1.
    OMAiEYTMLCM.
    OrthoDBiEOG7X0VJS.
    TreeFamiTF333004.

    Family and domain databases

    InterProiIPR009508. Transcrpt_activator_Churchill.
    [Graphical view]
    PfamiPF06573. Churchill. 1 hit.
    [Graphical view]
    ProDomiPD355092. Churchill. 1 hit.
    [Graphical view] [Entries sharing at least one domain]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8WUH1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRQPYLSSRE VSSSRKRWRT FPVDCVAMCG DCVEKEYPNR GNTCLENGSF    50
    LLNFTGCAVC SKRDFMLITN KSLKEEDGEE IVTYDHLCKN CHHVIARHEY 100
    TFSIMDEFQE YTMLCLLCGK AEDTISILPD DPRQMTLLF 139
    Length:139
    Mass (Da):16,111
    Last modified:May 29, 2013 - v2
    Checksum:i16B578B7DBC53CF9
    GO
    Isoform 2 (identifier: Q8WUH1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         86-86: H → PD

    Note: No experimental confirmation available.

    Show »
    Length:140
    Mass (Da):16,187
    Checksum:i01C9EA7F745A3954
    GO
    Isoform 3 (identifier: Q8WUH1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         86-139: HLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF → RVYHAVSVMRQSRRYYQYSP

    Show »
    Length:105
    Mass (Da):12,286
    Checksum:iF97F156E104D76D6
    GO

    Sequence cautioni

    The sequence AAG43128.1 differs from that shown. Reason: Frameshift at positions=92 and translation N-terminally extended.
    The sequence AAH20550.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAG51943.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1 – 33Missing in AAH20550. (PubMed:15489334)Curated

    Mass spectrometryi

    Molecular mass is 13033 Da from positions 28 - 139. Determined by MALDI. The mass difference may be explained by bound zinc ions.1 Publication

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei86 – 13954HLCKN…MTLLF → RVYHAVSVMRQSRRYYQYSP in isoform 3. CuratedVSP_046509Add
    BLAST
    Alternative sequencei86 – 861H → PD in isoform 2. 1 PublicationVSP_021021

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL135745 Genomic DNA. No translation available.
    AL139022 Genomic DNA. No translation available.
    CH471061 Genomic DNA. Translation: EAW80884.1.
    CH471061 Genomic DNA. Translation: EAW80887.1.
    BC020550 mRNA. Translation: AAH20550.1. Different initiation.
    AF060510 mRNA. Translation: AAG43128.1. Sequence problems.
    AK057626 mRNA. Translation: BAG51943.1. Different initiation.
    CCDSiCCDS32101.2. [Q8WUH1-2]
    CCDS55921.1. [Q8WUH1-1]
    CCDS55922.1. [Q8WUH1-3]
    RefSeqiNP_001190992.1. NM_001204063.1. [Q8WUH1-1]
    NP_001190993.1. NM_001204064.1. [Q8WUH1-3]
    NP_660148.3. NM_145165.3. [Q8WUH1-2]
    UniGeneiHs.731537.

    Genome annotation databases

    EnsembliENST00000548752; ENSP00000450165; ENSG00000258289. [Q8WUH1-3]
    ENST00000549115; ENSP00000448050; ENSG00000258289. [Q8WUH1-1]
    ENST00000552002; ENSP00000450144; ENSG00000258289.
    ENST00000607599; ENSP00000475473; ENSG00000258289. [Q8WUH1-2]
    GeneIDi91612.
    KEGGihsa:91612.
    UCSCiuc001xhv.3. human.
    uc001xhw.2. human.

    Polymorphism databases

    DMDMi510120833.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL135745 Genomic DNA. No translation available.
    AL139022 Genomic DNA. No translation available.
    CH471061 Genomic DNA. Translation: EAW80884.1 .
    CH471061 Genomic DNA. Translation: EAW80887.1 .
    BC020550 mRNA. Translation: AAH20550.1 . Different initiation.
    AF060510 mRNA. Translation: AAG43128.1 . Sequence problems.
    AK057626 mRNA. Translation: BAG51943.1 . Different initiation.
    CCDSi CCDS32101.2. [Q8WUH1-2 ]
    CCDS55921.1. [Q8WUH1-1 ]
    CCDS55922.1. [Q8WUH1-3 ]
    RefSeqi NP_001190992.1. NM_001204063.1. [Q8WUH1-1 ]
    NP_001190993.1. NM_001204064.1. [Q8WUH1-3 ]
    NP_660148.3. NM_145165.3. [Q8WUH1-2 ]
    UniGenei Hs.731537.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2JOX NMR - A 29-134 [» ]
    ProteinModelPortali Q8WUH1.
    SMRi Q8WUH1. Positions 29-134.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124853. 3 interactions.

    Polymorphism databases

    DMDMi 510120833.

    Proteomic databases

    MaxQBi Q8WUH1.
    PaxDbi Q8WUH1.
    PeptideAtlasi Q8WUH1.
    PRIDEi Q8WUH1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000548752 ; ENSP00000450165 ; ENSG00000258289 . [Q8WUH1-3 ]
    ENST00000549115 ; ENSP00000448050 ; ENSG00000258289 . [Q8WUH1-1 ]
    ENST00000552002 ; ENSP00000450144 ; ENSG00000258289 .
    ENST00000607599 ; ENSP00000475473 ; ENSG00000258289 . [Q8WUH1-2 ]
    GeneIDi 91612.
    KEGGi hsa:91612.
    UCSCi uc001xhv.3. human.
    uc001xhw.2. human.

    Organism-specific databases

    CTDi 91612.
    GeneCardsi GC14P065383.
    HGNCi HGNC:20099. CHURC1.
    HPAi CAB009260.
    HPA040072.
    MIMi 608577. gene.
    neXtProti NX_Q8WUH1.
    PharmGKBi PA134982480.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5029.
    HOGENOMi HOG000246424.
    HOVERGENi HBG039391.
    InParanoidi Q8WUH1.
    OMAi EYTMLCM.
    OrthoDBi EOG7X0VJS.
    TreeFami TF333004.

    Miscellaneous databases

    ChiTaRSi CHURC1. human.
    EvolutionaryTracei Q8WUH1.
    GenomeRNAii 91612.
    NextBioi 77335.
    PROi Q8WUH1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8WUH1.
    Bgeei Q8WUH1.
    CleanExi HS_CHURC1.
    Genevestigatori Q8WUH1.

    Family and domain databases

    InterProi IPR009508. Transcrpt_activator_Churchill.
    [Graphical view ]
    Pfami PF06573. Churchill. 1 hit.
    [Graphical view ]
    ProDomi PD355092. Churchill. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    ProtoNeti Search...

    Publicationsi

    1. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    4. Mao Y.M., Xie Y., Lin Q., Li Y., Dai J.L., Ying K.
      Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 11-139 (ISOFORM 2).
      Tissue: Fetal brain.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 13-139 (ISOFORM 1).
      Tissue: Trachea.
    6. "Embryonic neural inducing factor Churchill is not a DNA-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster."
      Lee B.M., Buck-Koehntop B.A., Martinez-Yamout M.A., Dyson H.J., Wright P.E.
      J. Mol. Biol. 371:1274-1289(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 29-136 IN COMPLEX WITH ZINC IONS, LACK OF DNA-BINDING, MASS SPECTROMETRY.

    Entry informationi

    Entry nameiCHUR_HUMAN
    AccessioniPrimary (citable) accession number: Q8WUH1
    Secondary accession number(s): B3KQ81
    , G3V1X3, G3V214, Q9H3K7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2003
    Last sequence update: May 29, 2013
    Last modified: October 1, 2014
    This is version 112 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3