Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WUH1

- CHUR_HUMAN

UniProt

Q8WUH1 - CHUR_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein Churchill

Gene

CHURC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Transcriptional activator that mediates FGF signaling during neural development. Plays a role in the regulation of cell movement (By similarity). Does not bind DNA by itself.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi29 – 291Zinc 1
Metal bindingi32 – 321Zinc 1
Metal bindingi57 – 571Zinc 1
Metal bindingi57 – 571Zinc 2
Metal bindingi60 – 601Zinc 2
Metal bindingi86 – 861Zinc 3
Metal bindingi88 – 881Zinc 2
Metal bindingi91 – 911Zinc 2
Metal bindingi93 – 931Zinc 1
Metal bindingi98 – 981Zinc 3
Metal bindingi115 – 1151Zinc 3
Metal bindingi118 – 1181Zinc 3

GO - Molecular functioni

  1. zinc ion binding Source: InterPro

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. positive regulation of transcription, DNA-templated Source: InterPro
  3. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Developmental protein

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Churchill
Gene namesi
Name:CHURC1
Synonyms:C14orf52, CHCH
ORF Names:My015
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:20099. CHURC1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134982480.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 139139Protein ChurchillPRO_0000089665Add
BLAST

Proteomic databases

MaxQBiQ8WUH1.
PaxDbiQ8WUH1.
PeptideAtlasiQ8WUH1.
PRIDEiQ8WUH1.

Expressioni

Gene expression databases

BgeeiQ8WUH1.
CleanExiHS_CHURC1.
ExpressionAtlasiQ8WUH1. baseline and differential.
GenevestigatoriQ8WUH1.

Organism-specific databases

HPAiCAB009260.
HPA040072.

Interactioni

Protein-protein interaction databases

BioGridi124853. 3 interactions.

Structurei

Secondary structure

1
139
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi33 – 375
Turni51 – 533
Beta strandi58 – 603
Beta strandi66 – 7611
Beta strandi79 – 8810
Turni89 – 913
Beta strandi94 – 10512
Beta strandi108 – 1158
Turni116 – 1183
Beta strandi119 – 1268

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2JOXNMR-A29-134[»]
ProteinModelPortaliQ8WUH1.
SMRiQ8WUH1. Positions 29-134.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WUH1.

Family & Domainsi

Sequence similaritiesi

Belongs to the Churchill family.Curated

Phylogenomic databases

eggNOGiCOG5029.
GeneTreeiENSGT00390000011163.
HOGENOMiHOG000246424.
HOVERGENiHBG039391.
InParanoidiQ8WUH1.
OMAiEYTMLCM.
OrthoDBiEOG7X0VJS.
TreeFamiTF333004.

Family and domain databases

InterProiIPR009508. Transcrpt_activator_Churchill.
[Graphical view]
PfamiPF06573. Churchill. 1 hit.
[Graphical view]
ProDomiPD355092. Churchill. 1 hit.
[Graphical view] [Entries sharing at least one domain]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8WUH1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRQPYLSSRE VSSSRKRWRT FPVDCVAMCG DCVEKEYPNR GNTCLENGSF
60 70 80 90 100
LLNFTGCAVC SKRDFMLITN KSLKEEDGEE IVTYDHLCKN CHHVIARHEY
110 120 130
TFSIMDEFQE YTMLCLLCGK AEDTISILPD DPRQMTLLF
Length:139
Mass (Da):16,111
Last modified:May 29, 2013 - v2
Checksum:i16B578B7DBC53CF9
GO
Isoform 2 (identifier: Q8WUH1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     86-86: H → PD

Note: No experimental confirmation available.

Show »
Length:140
Mass (Da):16,187
Checksum:i01C9EA7F745A3954
GO
Isoform 3 (identifier: Q8WUH1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     86-139: HLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF → RVYHAVSVMRQSRRYYQYSP

Show »
Length:105
Mass (Da):12,286
Checksum:iF97F156E104D76D6
GO

Sequence cautioni

The sequence AAG43128.1 differs from that shown. Reason: Frameshift at positions=92 and translation N-terminally extended.
The sequence AAH20550.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAG51943.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1 – 33Missing in AAH20550. (PubMed:15489334)Curated

Mass spectrometryi

Molecular mass is 13033 Da from positions 28 - 139. Determined by MALDI. The mass difference may be explained by bound zinc ions.1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei86 – 13954HLCKN…MTLLF → RVYHAVSVMRQSRRYYQYSP in isoform 3. CuratedVSP_046509Add
BLAST
Alternative sequencei86 – 861H → PD in isoform 2. 1 PublicationVSP_021021

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL135745 Genomic DNA. No translation available.
AL139022 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80884.1.
CH471061 Genomic DNA. Translation: EAW80887.1.
BC020550 mRNA. Translation: AAH20550.1. Different initiation.
AF060510 mRNA. Translation: AAG43128.1. Sequence problems.
AK057626 mRNA. Translation: BAG51943.1. Different initiation.
CCDSiCCDS32101.2. [Q8WUH1-2]
CCDS55921.1. [Q8WUH1-1]
CCDS55922.1. [Q8WUH1-3]
RefSeqiNP_001190992.1. NM_001204063.1. [Q8WUH1-1]
NP_001190993.1. NM_001204064.1. [Q8WUH1-3]
NP_660148.3. NM_145165.3. [Q8WUH1-2]
UniGeneiHs.731537.

Genome annotation databases

EnsembliENST00000359118; ENSP00000352026; ENSG00000258289.
ENST00000548752; ENSP00000450165; ENSG00000258289. [Q8WUH1-3]
ENST00000549115; ENSP00000448050; ENSG00000258289. [Q8WUH1-1]
ENST00000552002; ENSP00000450144; ENSG00000258289.
ENST00000607599; ENSP00000475473; ENSG00000258289. [Q8WUH1-2]
GeneIDi91612.
KEGGihsa:91612.
UCSCiuc001xhv.3. human.
uc001xhw.2. human.

Polymorphism databases

DMDMi510120833.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AL135745 Genomic DNA. No translation available.
AL139022 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80884.1 .
CH471061 Genomic DNA. Translation: EAW80887.1 .
BC020550 mRNA. Translation: AAH20550.1 . Different initiation.
AF060510 mRNA. Translation: AAG43128.1 . Sequence problems.
AK057626 mRNA. Translation: BAG51943.1 . Different initiation.
CCDSi CCDS32101.2. [Q8WUH1-2 ]
CCDS55921.1. [Q8WUH1-1 ]
CCDS55922.1. [Q8WUH1-3 ]
RefSeqi NP_001190992.1. NM_001204063.1. [Q8WUH1-1 ]
NP_001190993.1. NM_001204064.1. [Q8WUH1-3 ]
NP_660148.3. NM_145165.3. [Q8WUH1-2 ]
UniGenei Hs.731537.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2JOX NMR - A 29-134 [» ]
ProteinModelPortali Q8WUH1.
SMRi Q8WUH1. Positions 29-134.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124853. 3 interactions.

Polymorphism databases

DMDMi 510120833.

Proteomic databases

MaxQBi Q8WUH1.
PaxDbi Q8WUH1.
PeptideAtlasi Q8WUH1.
PRIDEi Q8WUH1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000359118 ; ENSP00000352026 ; ENSG00000258289 .
ENST00000548752 ; ENSP00000450165 ; ENSG00000258289 . [Q8WUH1-3 ]
ENST00000549115 ; ENSP00000448050 ; ENSG00000258289 . [Q8WUH1-1 ]
ENST00000552002 ; ENSP00000450144 ; ENSG00000258289 .
ENST00000607599 ; ENSP00000475473 ; ENSG00000258289 . [Q8WUH1-2 ]
GeneIDi 91612.
KEGGi hsa:91612.
UCSCi uc001xhv.3. human.
uc001xhw.2. human.

Organism-specific databases

CTDi 91612.
GeneCardsi GC14P065383.
HGNCi HGNC:20099. CHURC1.
HPAi CAB009260.
HPA040072.
MIMi 608577. gene.
neXtProti NX_Q8WUH1.
PharmGKBi PA134982480.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5029.
GeneTreei ENSGT00390000011163.
HOGENOMi HOG000246424.
HOVERGENi HBG039391.
InParanoidi Q8WUH1.
OMAi EYTMLCM.
OrthoDBi EOG7X0VJS.
TreeFami TF333004.

Miscellaneous databases

ChiTaRSi CHURC1. human.
EvolutionaryTracei Q8WUH1.
GenomeRNAii 91612.
NextBioi 77335.
PROi Q8WUH1.
SOURCEi Search...

Gene expression databases

Bgeei Q8WUH1.
CleanExi HS_CHURC1.
ExpressionAtlasi Q8WUH1. baseline and differential.
Genevestigatori Q8WUH1.

Family and domain databases

InterProi IPR009508. Transcrpt_activator_Churchill.
[Graphical view ]
Pfami PF06573. Churchill. 1 hit.
[Graphical view ]
ProDomi PD355092. Churchill. 1 hit.
[Graphical view ] [Entries sharing at least one domain ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Mao Y.M., Xie Y., Lin Q., Li Y., Dai J.L., Ying K.
    Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 11-139 (ISOFORM 2).
    Tissue: Fetal brain.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 13-139 (ISOFORM 1).
    Tissue: Trachea.
  6. "Embryonic neural inducing factor Churchill is not a DNA-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster."
    Lee B.M., Buck-Koehntop B.A., Martinez-Yamout M.A., Dyson H.J., Wright P.E.
    J. Mol. Biol. 371:1274-1289(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 29-136 IN COMPLEX WITH ZINC IONS, LACK OF DNA-BINDING, MASS SPECTROMETRY.

Entry informationi

Entry nameiCHUR_HUMAN
AccessioniPrimary (citable) accession number: Q8WUH1
Secondary accession number(s): B3KQ81
, G3V1X3, G3V214, Q9H3K7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2003
Last sequence update: May 29, 2013
Last modified: October 29, 2014
This is version 113 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3