Q8WUH1 (CHUR_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein Churchill | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 139 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional activator that mediates FGF signaling during neural development. Plays a role in the regulation of cell movement By similarity. Does not bind DNA by itself. |
| Sequence similarities | Belongs to the Churchill family. |
| Caution | It is uncertain whether Met-1 or Met-28 is the initiator. Some orthologous sequences cannot be extended. The protein analyzed in Ref.6 is derived from a construct starting at Met-28. |
| Mass spectrometry | Molecular mass is 13033 Da from positions 28 - 139. Determined by MALDI. The mass difference may be explained by bound zinc ions. Ref.6 |
| Sequence caution | The sequence AAG43128.1 differs from that shown. Reason: Frameshift at positions=92 and translation N-terminally extended. The sequence AAH20550.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAG51943.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Coding sequence diversity | Alternative splicing |
| Ligand | Metal-binding Zinc |
| Molecular function | Activator Developmental protein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW positive regulation of transcription, DNA-dependentInferred from electronic annotation. Source: InterPro transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8WUH1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8WUH1-2) The sequence of this isoform differs from the canonical sequence as follows: 86-86: H → PD | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8WUH1-3) The sequence of this isoform differs from the canonical sequence as follows: 86-139: HLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF → RVYHAVSVMRQSRRYYQYSP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 139 | 139 | Protein Churchill | PRO_0000089665 | ||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||
| Metal binding | 29 | 1 | Zinc 1 | |||||||||||||||||||||||
| Metal binding | 32 | 1 | Zinc 1 | |||||||||||||||||||||||
| Metal binding | 57 | 1 | Zinc 1 | |||||||||||||||||||||||
| Metal binding | 57 | 1 | Zinc 2 | |||||||||||||||||||||||
| Metal binding | 60 | 1 | Zinc 2 | |||||||||||||||||||||||
| Metal binding | 86 | 1 | Zinc 3 | |||||||||||||||||||||||
| Metal binding | 88 | 1 | Zinc 2 | |||||||||||||||||||||||
| Metal binding | 91 | 1 | Zinc 2 | |||||||||||||||||||||||
| Metal binding | 93 | 1 | Zinc 1 | |||||||||||||||||||||||
| Metal binding | 98 | 1 | Zinc 3 | |||||||||||||||||||||||
| Metal binding | 115 | 1 | Zinc 3 | |||||||||||||||||||||||
| Metal binding | 118 | 1 | Zinc 3 | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 86 – 139 | 54 | HLCKN…MTLLF → RVYHAVSVMRQSRRYYQYSP in isoform 3. | VSP_046509 | ||||||||||||||||||||||
| Alternative sequence | 86 | 1 | H → PD in isoform 2. | VSP_021021 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Sequence conflict | 1 – 3 | 3 | Missing in AAH20550. Ref.3 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Beta strand | 33 – 37 | 5 | ||||||||||||||||||||||||
| Turn | 51 – 53 | 3 | ||||||||||||||||||||||||
| Beta strand | 58 – 60 | 3 | ||||||||||||||||||||||||
| Beta strand | 66 – 76 | 11 | ||||||||||||||||||||||||
| Beta strand | 79 – 88 | 10 | ||||||||||||||||||||||||
| Turn | 89 – 91 | 3 | ||||||||||||||||||||||||
| Beta strand | 94 – 105 | 12 | ||||||||||||||||||||||||
| Beta strand | 108 – 115 | 8 | ||||||||||||||||||||||||
| Turn | 116 – 118 | 3 | ||||||||||||||||||||||||
| Beta strand | 119 – 126 | 8 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | Mao Y.M., Xie Y., Lin Q., Li Y., Dai J.L., Ying K. Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 11-139 (ISOFORM 2). Tissue: Fetal brain. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 13-139 (ISOFORM 1). Tissue: Trachea. |
| [6] | "Embryonic neural inducing factor Churchill is not a DNA-binding zinc finger protein: solution structure reveals a solvent-exposed beta-sheet and zinc binuclear cluster." Lee B.M., Buck-Koehntop B.A., Martinez-Yamout M.A., Dyson H.J., Wright P.E. J. Mol. Biol. 371:1274-1289(2007) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 29-136 IN COMPLEX WITH ZINC IONS, LACK OF DNA-BINDING, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AL135745 Genomic DNA. No translation available. AL139022 Genomic DNA. No translation available. CH471061 Genomic DNA. Translation: EAW80884.1. CH471061 Genomic DNA. Translation: EAW80887.1. BC020550 mRNA. Translation: AAH20550.1. Different initiation. AF060510 mRNA. Translation: AAG43128.1. Sequence problems. AK057626 mRNA. Translation: BAG51943.1. Different initiation. | ||||||||||||
| IPI | IPI00102920. IPI00797096. | ||||||||||||
| RefSeq | NP_001190992.1. NM_001204063.1. NP_660148.3. NM_145165.3. | ||||||||||||
| UniGene | Hs.731537. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8WUH1. | ||||||||||||
| ModBase | Search... | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 31340022. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q8WUH1. | ||||||||||||
| PeptideAtlas | Q8WUH1. | ||||||||||||
| PRIDE | Q8WUH1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000359118; ENSP00000352026; ENSG00000258289. ENST00000549115; ENSP00000448050; ENSG00000258289. ENST00000552002; ENSP00000450144; ENSG00000258289. | ||||||||||||
| GeneID | 91612. | ||||||||||||
| KEGG | hsa:91612. | ||||||||||||
| UCSC | uc001xhv.2. human. uc001xhw.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 91612. | ||||||||||||
| GeneCards | GC14P065383. GC14P065384. | ||||||||||||
| HGNC | HGNC:20099. CHURC1. | ||||||||||||
| HPA | CAB009260. HPA040072. | ||||||||||||
| MIM | 608577. gene. | ||||||||||||
| neXtProt | NX_Q8WUH1. | ||||||||||||
| PharmGKB | PA134982480. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5029. | ||||||||||||
| HOGENOM | HOG000246424. | ||||||||||||
| HOVERGEN | HBG039391. | ||||||||||||
| InParanoid | Q8WUH1. | ||||||||||||
| OrthoDB | EOG470TJQ. | ||||||||||||
| PhylomeDB | Q8WUH1. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8WUH1. | ||||||||||||
| Bgee | Q8WUH1. | ||||||||||||
| CleanEx | HS_CHURC1. | ||||||||||||
| Genevestigator | Q8WUH1. | ||||||||||||
| GermOnline | ENSG00000197195. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR009508. Transcrpt_activator_Churchill. [Graphical view] | ||||||||||||
| Pfam | PF06573. Churchill. 1 hit. [Graphical view] | ||||||||||||
| ProDom | PD355092. Churchill. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | CHURC1. human. | ||||||||||||
| EvolutionaryTrace | Q8WUH1. | ||||||||||||
| GenomeRNAi | 91612. | ||||||||||||
| NextBio | 77335. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CHUR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WUH1 Secondary accession number(s): B3KQ81 Q9H3K7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
