Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Stromal membrane-associated protein 2

Gene

SMAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GTPase activating protein that acts on ARF1. Can also activate ARF6 (in vitro). May play a role in clathrin-dependent retrograde transport from early endosomes to the trans-Golgi network (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri28 – 51C4-typePROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000084070-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Stromal membrane-associated protein 2
Alternative name(s):
Stromal membrane-associated protein 1-like
Gene namesi
Name:SMAP2
Synonyms:SMAP1L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:25082. SMAP2.

Subcellular locationi

  • Cytoplasm

  • Note: Detected in multiple foci throughout the cytoplasm and in juxtanuclear structures.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi64744.
MalaCardsiSMAP2.
OpenTargetsiENSG00000084070.
PharmGKBiPA162403939.

Polymorphism and mutation databases

BioMutaiSMAP2.
DMDMi74760545.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002358411 – 429Stromal membrane-associated protein 2Add BLAST429

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei127PhosphoserineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Modified residuei223PhosphoserineCombined sources1
Modified residuei225PhosphoserineCombined sources1
Modified residuei231PhosphoserineCombined sources1
Modified residuei240PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8WU79.
MaxQBiQ8WU79.
PaxDbiQ8WU79.
PeptideAtlasiQ8WU79.
PRIDEiQ8WU79.

PTM databases

iPTMnetiQ8WU79.
PhosphoSitePlusiQ8WU79.

Expressioni

Gene expression databases

BgeeiENSG00000084070.
CleanExiHS_SMAP2.
ExpressionAtlasiQ8WU79. baseline and differential.
GenevisibleiQ8WU79. HS.

Organism-specific databases

HPAiHPA021466.
HPA024424.

Interactioni

Subunit structurei

Interacts with ARF1. Interacts with PICALM and clathrin heavy chains (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
C1orf94Q6P1W53EBI-2822515,EBI-946029
DAB1O755533EBI-2822515,EBI-7875264
DAZAP2Q150385EBI-2822515,EBI-724310
FAM168AQ925673EBI-2822515,EBI-7957930
MAGED1Q9Y5V35EBI-2822515,EBI-716006

Protein-protein interaction databases

BioGridi122260. 25 interactors.
IntActiQ8WU79. 15 interactors.
STRINGi9606.ENSP00000361803.

Structurei

Secondary structure

1429
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi13 – 19Combined sources7
Helixi23 – 26Combined sources4
Turni29 – 31Combined sources3
Beta strandi38 – 40Combined sources3
Turni41 – 44Combined sources4
Beta strandi45 – 47Combined sources3
Helixi49 – 58Combined sources10
Turni60 – 62Combined sources3
Beta strandi65 – 67Combined sources3
Turni68 – 70Combined sources3
Helixi75 – 82Combined sources8
Helixi85 – 93Combined sources9
Turni94 – 96Combined sources3
Helixi107 – 118Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2IQJX-ray1.90A/B1-132[»]
ProteinModelPortaliQ8WU79.
SMRiQ8WU79.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8WU79.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini13 – 137Arf-GAPPROSITE-ProRule annotationAdd BLAST125

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni163 – 232Interaction with clathrin heavy chainsBy similarityAdd BLAST70
Regioni340 – 429Interaction with PICALMBy similarityAdd BLAST90

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi279 – 411Met-richAdd BLAST133

Sequence similaritiesi

Contains 1 Arf-GAP domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri28 – 51C4-typePROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG0703. Eukaryota.
COG5347. LUCA.
GeneTreeiENSGT00760000118874.
HOGENOMiHOG000230583.
HOVERGENiHBG055260.
InParanoidiQ8WU79.
KOiK12486.
OMAiCGTNGML.
OrthoDBiEOG091G0E7F.
PhylomeDBiQ8WU79.
TreeFamiTF313876.

Family and domain databases

InterProiIPR001164. ArfGAP.
[Graphical view]
PfamiPF01412. ArfGap. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00105. ArfGap. 1 hit.
[Graphical view]
PROSITEiPS50115. ARFGAP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8WU79-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTGKSVKDVD RYQAVLANLL LEEDNKFCAD CQSKGPRWAS WNIGVFICIR
60 70 80 90 100
CAGIHRNLGV HISRVKSVNL DQWTQEQIQC MQEMGNGKAN RLYEAYLPET
110 120 130 140 150
FRRPQIDPAV EGFIRDKYEK KKYMDRSLDI NAFRKEKDDK WKRGSEPVPE
160 170 180 190 200
KKLEPVVFEK VKMPQKKEDP QLPRKSSPKS TAPVMDLLGL DAPVACSIAN
210 220 230 240 250
SKTSNTLEKD LDLLASVPSP SSSGSRKVVG SMPTAGSAGS VPENLNLFPE
260 270 280 290 300
PGSKSEEIGK KQLSKDSILS LYGSQTPQMP TQAMFMAPAQ MAYPTAYPSF
310 320 330 340 350
PGVTPPNSIM GSMMPPPVGM VAQPGASGMV APMAMPAGYM GGMQASMMGV
360 370 380 390 400
PNGMMTTQQA GYMAGMAAMP QTVYGVQPAQ QLQWNLTQMT QQMAGMNFYG
410 420
ANGMMNYGQS MSGGNGQAAN QTLSPQMWK
Length:429
Mass (Da):46,786
Last modified:March 1, 2002 - v1
Checksum:iC2787BECAE37D6BD
GO
Isoform 2 (identifier: Q8WU79-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQS → MIF

Show »
Length:399
Mass (Da):43,490
Checksum:iA34167C6814FBC63
GO
Isoform 3 (identifier: Q8WU79-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.

Show »
Length:349
Mass (Da):37,697
Checksum:i113469E141B4ED20
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048327289A → T.Corresponds to variant rs34845213dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0437891 – 80Missing in isoform 3. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_0185041 – 33MTGKS…ADCQS → MIF in isoform 2. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL133206 mRNA. Translation: CAB61580.1.
AL137764 mRNA. Translation: CAB70912.1.
AK298702 mRNA. Translation: BAH12851.1.
AK303975 mRNA. Translation: BAH14088.1.
AK313105 mRNA. Translation: BAG35928.1.
AK316218 mRNA. Translation: BAH14589.1.
AL031985 Genomic DNA. Translation: CAI19853.1.
AL031985 Genomic DNA. Translation: CAI19854.1.
AL031985 Genomic DNA. Translation: CAI19855.1.
CH471059 Genomic DNA. Translation: EAX07220.1.
CH471059 Genomic DNA. Translation: EAX07222.1.
CH471059 Genomic DNA. Translation: EAX07221.1.
BC014512 mRNA. Translation: AAH14512.1.
BC021133 mRNA. Translation: AAH21133.1.
CCDSiCCDS451.1. [Q8WU79-1]
CCDS55592.1. [Q8WU79-2]
CCDS55593.1. [Q8WU79-3]
RefSeqiNP_001185907.1. NM_001198978.1. [Q8WU79-2]
NP_001185908.1. NM_001198979.1.
NP_001185909.1. NM_001198980.1. [Q8WU79-3]
NP_073570.1. NM_022733.2. [Q8WU79-1]
UniGeneiHs.15200.
Hs.602551.

Genome annotation databases

EnsembliENST00000372708; ENSP00000361793; ENSG00000084070. [Q8WU79-2]
ENST00000372718; ENSP00000361803; ENSG00000084070. [Q8WU79-1]
ENST00000539317; ENSP00000442835; ENSG00000084070. [Q8WU79-3]
GeneIDi64744.
KEGGihsa:64744.
UCSCiuc001cfj.4. human. [Q8WU79-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL133206 mRNA. Translation: CAB61580.1.
AL137764 mRNA. Translation: CAB70912.1.
AK298702 mRNA. Translation: BAH12851.1.
AK303975 mRNA. Translation: BAH14088.1.
AK313105 mRNA. Translation: BAG35928.1.
AK316218 mRNA. Translation: BAH14589.1.
AL031985 Genomic DNA. Translation: CAI19853.1.
AL031985 Genomic DNA. Translation: CAI19854.1.
AL031985 Genomic DNA. Translation: CAI19855.1.
CH471059 Genomic DNA. Translation: EAX07220.1.
CH471059 Genomic DNA. Translation: EAX07222.1.
CH471059 Genomic DNA. Translation: EAX07221.1.
BC014512 mRNA. Translation: AAH14512.1.
BC021133 mRNA. Translation: AAH21133.1.
CCDSiCCDS451.1. [Q8WU79-1]
CCDS55592.1. [Q8WU79-2]
CCDS55593.1. [Q8WU79-3]
RefSeqiNP_001185907.1. NM_001198978.1. [Q8WU79-2]
NP_001185908.1. NM_001198979.1.
NP_001185909.1. NM_001198980.1. [Q8WU79-3]
NP_073570.1. NM_022733.2. [Q8WU79-1]
UniGeneiHs.15200.
Hs.602551.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2IQJX-ray1.90A/B1-132[»]
ProteinModelPortaliQ8WU79.
SMRiQ8WU79.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122260. 25 interactors.
IntActiQ8WU79. 15 interactors.
STRINGi9606.ENSP00000361803.

PTM databases

iPTMnetiQ8WU79.
PhosphoSitePlusiQ8WU79.

Polymorphism and mutation databases

BioMutaiSMAP2.
DMDMi74760545.

Proteomic databases

EPDiQ8WU79.
MaxQBiQ8WU79.
PaxDbiQ8WU79.
PeptideAtlasiQ8WU79.
PRIDEiQ8WU79.

Protocols and materials databases

DNASUi64744.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372708; ENSP00000361793; ENSG00000084070. [Q8WU79-2]
ENST00000372718; ENSP00000361803; ENSG00000084070. [Q8WU79-1]
ENST00000539317; ENSP00000442835; ENSG00000084070. [Q8WU79-3]
GeneIDi64744.
KEGGihsa:64744.
UCSCiuc001cfj.4. human. [Q8WU79-1]

Organism-specific databases

CTDi64744.
DisGeNETi64744.
GeneCardsiSMAP2.
HGNCiHGNC:25082. SMAP2.
HPAiHPA021466.
HPA024424.
MalaCardsiSMAP2.
neXtProtiNX_Q8WU79.
OpenTargetsiENSG00000084070.
PharmGKBiPA162403939.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0703. Eukaryota.
COG5347. LUCA.
GeneTreeiENSGT00760000118874.
HOGENOMiHOG000230583.
HOVERGENiHBG055260.
InParanoidiQ8WU79.
KOiK12486.
OMAiCGTNGML.
OrthoDBiEOG091G0E7F.
PhylomeDBiQ8WU79.
TreeFamiTF313876.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000084070-MONOMER.

Miscellaneous databases

ChiTaRSiSMAP2. human.
EvolutionaryTraceiQ8WU79.
GenomeRNAii64744.
PROiQ8WU79.

Gene expression databases

BgeeiENSG00000084070.
CleanExiHS_SMAP2.
ExpressionAtlasiQ8WU79. baseline and differential.
GenevisibleiQ8WU79. HS.

Family and domain databases

InterProiIPR001164. ArfGAP.
[Graphical view]
PfamiPF01412. ArfGap. 1 hit.
[Graphical view]
PRINTSiPR00405. REVINTRACTNG.
SMARTiSM00105. ArfGap. 1 hit.
[Graphical view]
PROSITEiPS50115. ARFGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSMAP2_HUMAN
AccessioniPrimary (citable) accession number: Q8WU79
Secondary accession number(s): B2R7T1
, B7Z5B5, B7Z8V2, D3DPV2, Q5QPL2, Q96C93, Q9NST2, Q9UJL8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: March 1, 2002
Last modified: November 30, 2016
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.