Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Scavenger receptor class B member 1

Gene

SCARB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity. Receptor for hepatitis C virus glycoprotein E2. Binding between SCARB1 and E2 was found to be independent of the genotype of the viral isolate. Plays an important role in the uptake of HDL cholesteryl ester (By similarity).By similarity

GO - Molecular functioni

  • 1-phosphatidylinositol binding Source: BHF-UCL
  • apolipoprotein A-I binding Source: BHF-UCL
  • apolipoprotein binding Source: BHF-UCL
  • high-density lipoprotein particle binding Source: Ensembl
  • high-density lipoprotein particle receptor activity Source: BHF-UCL
  • lipopolysaccharide binding Source: BHF-UCL
  • lipopolysaccharide receptor activity Source: BHF-UCL
  • low-density lipoprotein particle binding Source: BHF-UCL
  • phosphatidylserine binding Source: BHF-UCL
  • transporter activity Source: ProtInc

GO - Biological processi

  • adhesion of symbiont to host Source: BHF-UCL
  • androgen biosynthetic process Source: Ensembl
  • blood vessel endothelial cell migration Source: Ensembl
  • cell adhesion Source: InterPro
  • cholesterol catabolic process Source: Ensembl
  • cholesterol efflux Source: AgBase
  • cholesterol homeostasis Source: BHF-UCL
  • cholesterol import Source: AgBase
  • detection of lipopolysaccharide Source: BHF-UCL
  • endothelial cell proliferation Source: Ensembl
  • high-density lipoprotein particle clearance Source: BHF-UCL
  • high-density lipoprotein particle remodeling Source: BHF-UCL
  • lipopolysaccharide-mediated signaling pathway Source: GOC
  • lipopolysaccharide transport Source: BHF-UCL
  • lipoprotein metabolic process Source: Reactome
  • low-density lipoprotein particle clearance Source: BHF-UCL
  • phospholipid transport Source: BHF-UCL
  • positive regulation of cholesterol storage Source: BHF-UCL
  • positive regulation of endothelial cell migration Source: BHF-UCL
  • positive regulation of nitric-oxide synthase activity Source: BHF-UCL
  • positive regulation of triglyceride biosynthetic process Source: BHF-UCL
  • receptor-mediated endocytosis Source: Reactome
  • recognition of apoptotic cell Source: BHF-UCL
  • regulation of phagocytosis Source: BHF-UCL
  • regulation of phosphatidylcholine catabolic process Source: BHF-UCL
  • reverse cholesterol transport Source: BHF-UCL
  • small molecule metabolic process Source: Reactome
  • triglyceride homeostasis Source: BHF-UCL
  • viral process Source: UniProtKB-KW
  • vitamin transmembrane transport Source: AgBase
  • wound healing Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Host-virus interaction

Enzyme and pathway databases

ReactomeiREACT_13621. HDL-mediated lipid transport.
REACT_163679. Scavenging by Class B Receptors.

Protein family/group databases

TCDBi9.B.39.1.3. the long chain fatty acid translocase (lcfat) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Scavenger receptor class B member 1
Short name:
SRB1
Alternative name(s):
CD36 and LIMPII analogous 1
Short name:
CLA-1
CD36 antigen-like 1
Collagen type I receptor, thrombospondin receptor-like 1
SR-BI
CD_antigen: CD36
Gene namesi
Name:SCARB1
Synonyms:CD36L1, CLA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:1664. SCARB1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1111CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei12 – 3221HelicalSequence AnalysisAdd
BLAST
Topological domaini33 – 443411ExtracellularSequence AnalysisAdd
BLAST
Transmembranei444 – 46421HelicalSequence AnalysisAdd
BLAST
Topological domaini465 – 55288CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  • caveola Source: BHF-UCL
  • cell surface Source: BHF-UCL
  • endocytic vesicle membrane Source: Reactome
  • extracellular exosome Source: UniProtKB
  • integral component of plasma membrane Source: Ensembl
  • lysosomal membrane Source: UniProtKB
  • microvillus membrane Source: Ensembl
  • plasma membrane Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

MIMi610762. phenotype.
PharmGKBiPA97.

Chemistry

DrugBankiDB00144. Phosphatidylserine.

Polymorphism and mutation databases

BioMutaiSCARB1.
DMDMi37999904.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 552552Scavenger receptor class B member 1PRO_0000144160Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi102 – 1021N-linked (GlcNAc...)1 Publication
Glycosylationi108 – 1081N-linked (GlcNAc...)Sequence Analysis
Glycosylationi173 – 1731N-linked (GlcNAc...)Sequence Analysis
Glycosylationi212 – 2121N-linked (GlcNAc...)Sequence Analysis
Glycosylationi227 – 2271N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi251 ↔ 384By similarity
Glycosylationi255 – 2551N-linked (GlcNAc...)Sequence Analysis
Glycosylationi310 – 3101N-linked (GlcNAc...)Sequence Analysis
Glycosylationi330 – 3301N-linked (GlcNAc...)1 Publication
Glycosylationi383 – 3831N-linked (GlcNAc...)Sequence Analysis
Isoform 2 (identifier: Q8WTV0-3)
Modified residuei393 – 3931Phosphoserine1 Publication
Isoform 4 (identifier: Q8WTV0-4)
Modified residuei458 – 4581Phosphoserine1 Publication
Isoform 1 (identifier: Q8WTV0-2)
Modified residuei493 – 4931Phosphoserine1 Publication

Post-translational modificationi

N-glycosylated.2 Publications
The six cysteines of the extracellular domain are all involved in intramolecular disulfide bonds.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8WTV0.
PaxDbiQ8WTV0.
PRIDEiQ8WTV0.

PTM databases

PhosphoSiteiQ8WTV0.

Expressioni

Tissue specificityi

Widely expressed.

Gene expression databases

BgeeiQ8WTV0.
CleanExiHS_SCARB1.
ExpressionAtlasiQ8WTV0. baseline and differential.
GenevisibleiQ8WTV0. HS.

Organism-specific databases

HPAiCAB070124.

Interactioni

Subunit structurei

Plays a critical role in HCV attachment and/or cell entry by interacting with HCV E1/E2 glycoproteins heterodimer. The C-terminal region binds to PDZK1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
P279582EBI-78657,EBI-6904269From a different organism.
KRTAP10-9P604113EBI-78657,EBI-10172052
KRTAP5-9P263713EBI-78657,EBI-3958099

Protein-protein interaction databases

BioGridi107387. 15 interactions.
IntActiQ8WTV0. 8 interactions.
MINTiMINT-5001419.
STRINGi9606.ENSP00000261693.

Structurei

3D structure databases

ProteinModelPortaliQ8WTV0.
SMRiQ8WTV0. Positions 37-426.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CD36 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG257244.
GeneTreeiENSGT00530000062927.
HOVERGENiHBG106577.
InParanoidiQ8WTV0.
KOiK13885.
OMAiPDACRSM.
OrthoDBiEOG79SDWX.
PhylomeDBiQ8WTV0.
TreeFamiTF317925.

Family and domain databases

InterProiIPR002159. CD36.
IPR005428. CD36_antigen.
[Graphical view]
PANTHERiPTHR11923. PTHR11923. 1 hit.
PfamiPF01130. CD36. 1 hit.
[Graphical view]
PRINTSiPR01610. CD36ANTIGEN.
PR01609. CD36FAMILY.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q8WTV0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCSAKARWA AGALGVAGLL CAVLGAVMIV MVPSLIKQQV LKNVRIDPSS
60 70 80 90 100
LSFNMWKEIP IPFYLSVYFF DVMNPSEILK GEKPQVRERG PYVYREFRHK
110 120 130 140 150
SNITFNNNDT VSFLEYRTFQ FQPSKSHGSE SDYIVMPNIL VLGAAVMMEN
160 170 180 190 200
KPMTLKLIMT LAFTTLGERA FMNRTVGEIM WGYKDPLVNL INKYFPGMFP
210 220 230 240 250
FKDKFGLFAE LNNSDSGLFT VFTGVQNISR IHLVDKWNGL SKVDFWHSDQ
260 270 280 290 300
CNMINGTSGQ MWPPFMTPES SLEFYSPEAC RSMKLMYKES GVFEGIPTYR
310 320 330 340 350
FVAPKTLFAN GSIYPPNEGF CPCLESGIQN VSTCRFSAPL FLSHPHFLNA
360 370 380 390 400
DPVLAEAVTG LHPNQEAHSL FLDIHPVTGI PMNCSVKLQL SLYMKSVAGI
410 420 430 440 450
GQTGKIEPVV LPLLWFAESG AMEGETLHTF YTQLVLMPKV MHYAQYVLLA
460 470 480 490 500
LGCVLLLVPV ICQIRSQVGA GQRAARADSH SLACWGKGAS DRTLWPTAAW
510 520 530 540 550
SPPPAAVLRL CRSGSGHCWG LRSTLASFAC RVATTLPVLE GLGPSLGGGT

GS
Note: May be due to a competing donor splice site. No experimental confirmation available.
Length:552
Mass (Da):60,878
Last modified:March 1, 2002 - v1
Checksum:i06B0BD771FEA284F
GO
Isoform 1 (identifier: Q8WTV0-2) [UniParc]FASTAAdd to basket

Also known as: SR-BI

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:509
Mass (Da):56,973
Checksum:i0184AE9CEC595374
GO
Isoform 2 (identifier: Q8WTV0-3) [UniParc]FASTAAdd to basket

Also known as: SR-BII

The sequence of this isoform differs from the canonical sequence as follows:
     43-142: Missing.
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:409
Mass (Da):45,103
Checksum:i88B30340CD403541
GO
Isoform 4 (identifier: Q8WTV0-4) [UniParc]FASTAAdd to basket

Also known as: SR-BIII

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLK → MALQPSW
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:474
Mass (Da):53,579
Checksum:i1CF55DEB32EF3D3B
GO
Isoform 5 (identifier: Q8WTV0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → GPEDTVSQPG...PSGQPPSPTA

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:506
Mass (Da):56,170
Checksum:i73C1ED23924F2B49
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti70 – 701F → L in AAQ08185 (Ref. 2) Curated
Sequence conflicti97 – 971F → S in CAA80277 (PubMed:7689561).Curated

Polymorphismi

Genetic variations in SCARB1 define the high density lipoprotein cholesterol level quantitative trait locus 6 (HDLCQ16) [MIMi:610762].

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti2 – 21G → S Associated with higher plasma triglyceride concentration in subjects with hypercholesterolemia. 2 Publications
Corresponds to variant rs4238001 [ dbSNP | Ensembl ].
VAR_017098
Natural varianti135 – 1351V → I.1 Publication
Corresponds to variant rs5891 [ dbSNP | Ensembl ].
VAR_017099
Natural varianti167 – 1671G → S.1 Publication
Corresponds to variant rs199588922 [ dbSNP | Ensembl ].
VAR_017100
Natural varianti229 – 2291S → G.
Corresponds to variant rs10396213 [ dbSNP | Ensembl ].
VAR_019507
Natural varianti297 – 2971P → S Mutation carriers have increased HDL cholesterol levels and a reduction in cholesterol efflux from macrophages. 1 Publication
VAR_064909
Natural varianti511 – 5111C → R.
Corresponds to variant rs2293440 [ dbSNP | Ensembl ].
VAR_017101

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4242MGCSA…QQVLK → MALQPSW in isoform 4. 1 PublicationVSP_011037Add
BLAST
Alternative sequencei43 – 142100Missing in isoform 2. 1 PublicationVSP_008553Add
BLAST
Alternative sequencei468 – 55285VGAGQ…GGTGS → EKCYLFWSSSKKGSKDKEAI QAYSESLMTSAPKGSVLQEA KL in isoform 1, isoform 2 and isoform 4. 3 PublicationsVSP_008554Add
BLAST
Alternative sequencei468 – 55285VGAGQ…GGTGS → GPEDTVSQPGLAAGPDRPPS PYTPLLPDSPSGQPPSPTA in isoform 5. CuratedVSP_054083Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z22555 mRNA. Translation: CAA80277.1.
AF515445 mRNA. Translation: AAQ08185.1.
AC073593 Genomic DNA. No translation available.
AC126309 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW98459.1.
BC022087 mRNA. No translation available.
BC080647 mRNA. Translation: AAH80647.1.
BC093732 mRNA. Translation: AAH93732.1.
BC112037 mRNA. Translation: AAI12038.1.
CCDSiCCDS45008.1. [Q8WTV0-5]
CCDS9259.1. [Q8WTV0-2]
PIRiS36656. A48528.
RefSeqiNP_001076428.1. NM_001082959.1. [Q8WTV0-5]
NP_005496.4. NM_005505.4. [Q8WTV0-2]
UniGeneiHs.731377.

Genome annotation databases

EnsembliENST00000339570; ENSP00000343795; ENSG00000073060. [Q8WTV0-5]
ENST00000415380; ENSP00000414979; ENSG00000073060.
GeneIDi949.
KEGGihsa:949.
UCSCiuc001ugm.4. human. [Q8WTV0-2]
uc001ugo.4. human. [Q8WTV0-1]
uc031qke.1. human. [Q8WTV0-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z22555 mRNA. Translation: CAA80277.1.
AF515445 mRNA. Translation: AAQ08185.1.
AC073593 Genomic DNA. No translation available.
AC126309 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW98459.1.
BC022087 mRNA. No translation available.
BC080647 mRNA. Translation: AAH80647.1.
BC093732 mRNA. Translation: AAH93732.1.
BC112037 mRNA. Translation: AAI12038.1.
CCDSiCCDS45008.1. [Q8WTV0-5]
CCDS9259.1. [Q8WTV0-2]
PIRiS36656. A48528.
RefSeqiNP_001076428.1. NM_001082959.1. [Q8WTV0-5]
NP_005496.4. NM_005505.4. [Q8WTV0-2]
UniGeneiHs.731377.

3D structure databases

ProteinModelPortaliQ8WTV0.
SMRiQ8WTV0. Positions 37-426.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107387. 15 interactions.
IntActiQ8WTV0. 8 interactions.
MINTiMINT-5001419.
STRINGi9606.ENSP00000261693.

Chemistry

BindingDBiQ8WTV0.
ChEMBLiCHEMBL1914272.
DrugBankiDB00144. Phosphatidylserine.

Protein family/group databases

TCDBi9.B.39.1.3. the long chain fatty acid translocase (lcfat) family.

PTM databases

PhosphoSiteiQ8WTV0.

Polymorphism and mutation databases

BioMutaiSCARB1.
DMDMi37999904.

Proteomic databases

MaxQBiQ8WTV0.
PaxDbiQ8WTV0.
PRIDEiQ8WTV0.

Protocols and materials databases

DNASUi949.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339570; ENSP00000343795; ENSG00000073060. [Q8WTV0-5]
ENST00000415380; ENSP00000414979; ENSG00000073060.
GeneIDi949.
KEGGihsa:949.
UCSCiuc001ugm.4. human. [Q8WTV0-2]
uc001ugo.4. human. [Q8WTV0-1]
uc031qke.1. human. [Q8WTV0-4]

Organism-specific databases

CTDi949.
GeneCardsiGC12M125262.
HGNCiHGNC:1664. SCARB1.
HPAiCAB070124.
MIMi601040. gene.
610762. phenotype.
neXtProtiNX_Q8WTV0.
PharmGKBiPA97.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG257244.
GeneTreeiENSGT00530000062927.
HOVERGENiHBG106577.
InParanoidiQ8WTV0.
KOiK13885.
OMAiPDACRSM.
OrthoDBiEOG79SDWX.
PhylomeDBiQ8WTV0.
TreeFamiTF317925.

Enzyme and pathway databases

ReactomeiREACT_13621. HDL-mediated lipid transport.
REACT_163679. Scavenging by Class B Receptors.

Miscellaneous databases

ChiTaRSiSCARB1. human.
GeneWikiiSCARB1.
GenomeRNAii949.
NextBioi3946.
PROiQ8WTV0.
SOURCEiSearch...

Gene expression databases

BgeeiQ8WTV0.
CleanExiHS_SCARB1.
ExpressionAtlasiQ8WTV0. baseline and differential.
GenevisibleiQ8WTV0. HS.

Family and domain databases

InterProiIPR002159. CD36.
IPR005428. CD36_antigen.
[Graphical view]
PANTHERiPTHR11923. PTHR11923. 1 hit.
PfamiPF01130. CD36. 1 hit.
[Graphical view]
PRINTSiPR01610. CD36ANTIGEN.
PR01609. CD36FAMILY.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification, primary structure and distribution of CLA-1, a novel member of the CD36/LIMPII gene family."
    Calvo D., Vega M.
    J. Biol. Chem. 268:18929-18935(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Promyelocyte.
  2. Hirano K., Yamashita S., Matsuzawa Y.
    Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Liver, Prostate and Rhabdomyosarcoma.
  6. "The human scavenger receptor class B type I is a novel candidate receptor for the hepatitis C virus."
    Scarselli E., Ansuini H., Cerino R., Roccasecca R.M., Acali S., Filocamo G., Traboni C., Nicosia A., Cortese R., Vitelli A.
    EMBO J. 21:5017-5025(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  7. "Phosphatidylserine binding of class B scavenger receptor type I, a phagocytosis receptor of testicular Sertoli cells."
    Kawasaki Y., Nakagawa A., Nagaosa K., Shiratsuchi A., Nakanishi Y.
    J. Biol. Chem. 277:27559-27566(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION.
  8. "Cell entry of hepatitis C virus requires a set of co-receptors that include the CD81 tetraspanin and the SR-B1 scavenger receptor."
    Bartosch B., Vitelli A., Granier C., Goujon C., Dubuisson J., Pascale S., Scarselli E., Cortese R., Nicosia A., Cosset F.-L.
    J. Biol. Chem. 278:41624-41630(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HCV E1/E2 ENVELOPE HETERODIMER.
  9. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-102 AND ASN-330.
    Tissue: Liver.
  10. "Biological, clinical and population relevance of 95 loci for blood lipids."
    Teslovich T.M., Musunuru K., Smith A.V., Edmondson A.C., Stylianou I.M., Koseki M., Pirruccello J.P., Ripatti S., Chasman D.I., Willer C.J., Johansen C.T., Fouchier S.W., Isaacs A., Peloso G.M., Barbalic M., Ricketts S.L., Bis J.C., Aulchenko Y.S.
    , Thorleifsson G., Feitosa M.F., Chambers J., Orho-Melander M., Melander O., Johnson T., Li X., Guo X., Li M., Shin Cho Y., Jin Go M., Jin Kim Y., Lee J.Y., Park T., Kim K., Sim X., Twee-Hee Ong R., Croteau-Chonka D.C., Lange L.A., Smith J.D., Song K., Hua Zhao J., Yuan X., Luan J., Lamina C., Ziegler A., Zhang W., Zee R.Y., Wright A.F., Witteman J.C., Wilson J.F., Willemsen G., Wichmann H.E., Whitfield J.B., Waterworth D.M., Wareham N.J., Waeber G., Vollenweider P., Voight B.F., Vitart V., Uitterlinden A.G., Uda M., Tuomilehto J., Thompson J.R., Tanaka T., Surakka I., Stringham H.M., Spector T.D., Soranzo N., Smit J.H., Sinisalo J., Silander K., Sijbrands E.J., Scuteri A., Scott J., Schlessinger D., Sanna S., Salomaa V., Saharinen J., Sabatti C., Ruokonen A., Rudan I., Rose L.M., Roberts R., Rieder M., Psaty B.M., Pramstaller P.P., Pichler I., Perola M., Penninx B.W., Pedersen N.L., Pattaro C., Parker A.N., Pare G., Oostra B.A., O'Donnell C.J., Nieminen M.S., Nickerson D.A., Montgomery G.W., Meitinger T., McPherson R., McCarthy M.I., McArdle W., Masson D., Martin N.G., Marroni F., Mangino M., Magnusson P.K., Lucas G., Luben R., Loos R.J., Lokki M.L., Lettre G., Langenberg C., Launer L.J., Lakatta E.G., Laaksonen R., Kyvik K.O., Kronenberg F., Konig I.R., Khaw K.T., Kaprio J., Kaplan L.M., Johansson A., Jarvelin M.R., Janssens A.C., Ingelsson E., Igl W., Kees Hovingh G., Hottenga J.J., Hofman A., Hicks A.A., Hengstenberg C., Heid I.M., Hayward C., Havulinna A.S., Hastie N.D., Harris T.B., Haritunians T., Hall A.S., Gyllensten U., Guiducci C., Groop L.C., Gonzalez E., Gieger C., Freimer N.B., Ferrucci L., Erdmann J., Elliott P., Ejebe K.G., Doring A., Dominiczak A.F., Demissie S., Deloukas P., de Geus E.J., de Faire U., Crawford G., Collins F.S., Chen Y.D., Caulfield M.J., Campbell H., Burtt N.P., Bonnycastle L.L., Boomsma D.I., Boekholdt S.M., Bergman R.N., Barroso I., Bandinelli S., Ballantyne C.M., Assimes T.L., Quertermous T., Altshuler D., Seielstad M., Wong T.Y., Tai E.S., Feranil A.B., Kuzawa C.W., Adair L.S., Taylor H.A. Jr., Borecki I.B., Gabriel S.B., Wilson J.G., Holm H., Thorsteinsdottir U., Gudnason V., Krauss R.M., Mohlke K.L., Ordovas J.M., Munroe P.B., Kooner J.S., Tall A.R., Hegele R.A., Kastelein J.J., Schadt E.E., Rotter J.I., Boerwinkle E., Strachan D.P., Mooser V., Stefansson K., Reilly M.P., Samani N.J., Schunkert H., Cupples L.A., Sandhu M.S., Ridker P.M., Rader D.J., van Duijn C.M., Peltonen L., Abecasis G.R., Boehnke M., Kathiresan S.
    Nature 466:707-713(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN HDLCQ16.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-493 (ISOFORM 1), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-393 (ISOFORM 2), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-458 (ISOFORM 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  13. "Polymorphisms at the SRBI locus are associated with lipoprotein levels in subjects with heterozygous familial hypercholesterolemia."
    Tai E.S., Adiconis X., Ordovas J.M., Carmena-Ramon R., Real J., Corella D., Ascaso J., Carmena R.
    Clin. Genet. 63:53-58(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT SER-2.
  14. "Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors."
    Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C.
    Hum. Mol. Genet. 12:2733-2743(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS SER-2; ILE-135 AND SER-167.
  15. Cited for: VARIANT SER-297, INVOLVEMENT IN HDLCQ16.

Entry informationi

Entry nameiSCRB1_HUMAN
AccessioniPrimary (citable) accession number: Q8WTV0
Secondary accession number(s): F8W8N0
, Q14016, Q52LZ5, Q6KFX4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: March 1, 2002
Last modified: July 22, 2015
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.