SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8WTV0

- SCRB1_HUMAN

UniProt

Q8WTV0 - SCRB1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Scavenger receptor class B member 1
Gene
SCARB1, CD36L1, CLA1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity. Receptor for hepatitis C virus glycoprotein E2. Binding between SCARB1 and E2 was found to be independent of the genotype of the viral isolate. Plays an important role in the uptake of HDL cholesteryl ester By similarity.1 Publication

GO - Molecular functioni

  1. 1-phosphatidylinositol binding Source: BHF-UCL
  2. apolipoprotein A-I binding Source: BHF-UCL
  3. apolipoprotein binding Source: BHF-UCL
  4. high-density lipoprotein particle binding Source: Ensembl
  5. high-density lipoprotein particle receptor activity Source: BHF-UCL
  6. lipopolysaccharide binding Source: BHF-UCL
  7. lipopolysaccharide receptor activity Source: BHF-UCL
  8. low-density lipoprotein particle binding Source: BHF-UCL
  9. phosphatidylserine binding Source: BHF-UCL
  10. protein binding Source: IntAct
  11. transporter activity Source: ProtInc
Complete GO annotation...

GO - Biological processi

  1. adhesion of symbiont to host Source: BHF-UCL
  2. androgen biosynthetic process Source: Ensembl
  3. blood vessel endothelial cell migration Source: Ensembl
  4. cell adhesion Source: InterPro
  5. cholesterol catabolic process Source: Ensembl
  6. cholesterol efflux Source: BHF-UCL
  7. cholesterol homeostasis Source: BHF-UCL
  8. cholesterol import Source: BHF-UCL
  9. detection of lipopolysaccharide Source: BHF-UCL
  10. endothelial cell proliferation Source: Ensembl
  11. high-density lipoprotein particle clearance Source: BHF-UCL
  12. high-density lipoprotein particle remodeling Source: BHF-UCL
  13. lipopolysaccharide transport Source: BHF-UCL
  14. lipopolysaccharide-mediated signaling pathway Source: GOC
  15. lipoprotein metabolic process Source: Reactome
  16. low-density lipoprotein particle clearance Source: BHF-UCL
  17. phospholipid transport Source: BHF-UCL
  18. positive regulation of cholesterol storage Source: BHF-UCL
  19. positive regulation of endothelial cell migration Source: BHF-UCL
  20. positive regulation of nitric-oxide synthase activity Source: BHF-UCL
  21. positive regulation of triglyceride biosynthetic process Source: BHF-UCL
  22. receptor-mediated endocytosis Source: GOC
  23. recognition of apoptotic cell Source: BHF-UCL
  24. regulation of phagocytosis Source: BHF-UCL
  25. regulation of phosphatidylcholine catabolic process Source: BHF-UCL
  26. reverse cholesterol transport Source: BHF-UCL
  27. small molecule metabolic process Source: Reactome
  28. triglyceride homeostasis Source: BHF-UCL
  29. viral process Source: UniProtKB-KW
  30. wound healing Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Host-virus interaction

Enzyme and pathway databases

ReactomeiREACT_13621. HDL-mediated lipid transport.
REACT_163679. Scavenging by Class B Receptors.

Protein family/group databases

TCDBi9.B.39.1.3. the long chain fatty acid translocase (lcfat) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Scavenger receptor class B member 1
Short name:
SRB1
Alternative name(s):
CD36 and LIMPII analogous 1
Short name:
CLA-1
CD36 antigen-like 1
Collagen type I receptor, thrombospondin receptor-like 1
SR-BI
CD_antigen: CD36
Gene namesi
Name:SCARB1
Synonyms:CD36L1, CLA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:1664. SCARB1.

Subcellular locationi

Cell membrane; Multi-pass membrane protein. Membranecaveola; Multi-pass membrane protein
Note: Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1111Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei12 – 3221Helical; Reviewed prediction
Add
BLAST
Topological domaini33 – 443411Extracellular Reviewed prediction
Add
BLAST
Transmembranei444 – 46421Helical; Reviewed prediction
Add
BLAST
Topological domaini465 – 55288Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. caveola Source: BHF-UCL
  2. cell surface Source: Ensembl
  3. endocytic vesicle membrane Source: Reactome
  4. extracellular vesicular exosome Source: UniProt
  5. integral component of plasma membrane Source: Ensembl
  6. lysosomal membrane Source: UniProtKB
  7. microvillus membrane Source: Ensembl
  8. plasma membrane Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

MIMi610762. phenotype.
PharmGKBiPA97.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 552552Scavenger receptor class B member 1
PRO_0000144160Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi102 – 1021N-linked (GlcNAc...)1 Publication
Glycosylationi108 – 1081N-linked (GlcNAc...) Reviewed prediction
Glycosylationi173 – 1731N-linked (GlcNAc...) Reviewed prediction
Glycosylationi212 – 2121N-linked (GlcNAc...) Reviewed prediction
Glycosylationi227 – 2271N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi251 ↔ 384 By similarity
Glycosylationi255 – 2551N-linked (GlcNAc...) Reviewed prediction
Glycosylationi310 – 3101N-linked (GlcNAc...) Reviewed prediction
Glycosylationi330 – 3301N-linked (GlcNAc...)1 Publication
Glycosylationi383 – 3831N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

N-glycosylated.1 Publication
The six cysteines of the extracellular domain are all involved in intramolecular disulfide bonds By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ8WTV0.
PaxDbiQ8WTV0.
PRIDEiQ8WTV0.

PTM databases

PhosphoSiteiQ8WTV0.

Expressioni

Tissue specificityi

Widely expressed.

Gene expression databases

ArrayExpressiQ8WTV0.
BgeeiQ8WTV0.
CleanExiHS_SCARB1.
GenevestigatoriQ8WTV0.

Interactioni

Subunit structurei

Plays a critical role in HCV attachment and/or cell entry by interacting with HCV E1/E2 glycoproteins heterodimer. The C-terminal region binds to PDZK1 By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
P279582EBI-78657,EBI-6904269From a different organism.

Protein-protein interaction databases

BioGridi107387. 7 interactions.
IntActiQ8WTV0. 6 interactions.
MINTiMINT-5001419.
STRINGi9606.ENSP00000261693.

Structurei

3D structure databases

ProteinModelPortaliQ8WTV0.
SMRiQ8WTV0. Positions 51-434.

Family & Domainsi

Sequence similaritiesi

Belongs to the CD36 family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG257244.
HOVERGENiHBG106577.
InParanoidiQ8WTV0.
KOiK13885.
OMAiDNDTVSF.
OrthoDBiEOG79SDWX.
PhylomeDBiQ8WTV0.
TreeFamiTF317925.

Family and domain databases

InterProiIPR002159. CD36.
IPR005428. CD36_antigen.
[Graphical view]
PANTHERiPTHR11923. PTHR11923. 1 hit.
PfamiPF01130. CD36. 1 hit.
[Graphical view]
PRINTSiPR01610. CD36ANTIGEN.
PR01609. CD36FAMILY.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: Q8WTV0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGCSAKARWA AGALGVAGLL CAVLGAVMIV MVPSLIKQQV LKNVRIDPSS    50
LSFNMWKEIP IPFYLSVYFF DVMNPSEILK GEKPQVRERG PYVYREFRHK 100
SNITFNNNDT VSFLEYRTFQ FQPSKSHGSE SDYIVMPNIL VLGAAVMMEN 150
KPMTLKLIMT LAFTTLGERA FMNRTVGEIM WGYKDPLVNL INKYFPGMFP 200
FKDKFGLFAE LNNSDSGLFT VFTGVQNISR IHLVDKWNGL SKVDFWHSDQ 250
CNMINGTSGQ MWPPFMTPES SLEFYSPEAC RSMKLMYKES GVFEGIPTYR 300
FVAPKTLFAN GSIYPPNEGF CPCLESGIQN VSTCRFSAPL FLSHPHFLNA 350
DPVLAEAVTG LHPNQEAHSL FLDIHPVTGI PMNCSVKLQL SLYMKSVAGI 400
GQTGKIEPVV LPLLWFAESG AMEGETLHTF YTQLVLMPKV MHYAQYVLLA 450
LGCVLLLVPV ICQIRSQVGA GQRAARADSH SLACWGKGAS DRTLWPTAAW 500
SPPPAAVLRL CRSGSGHCWG LRSTLASFAC RVATTLPVLE GLGPSLGGGT 550
GS 552

Note: May be due to a competing donor splice site. No experimental confirmation available.

Length:552
Mass (Da):60,878
Last modified:March 1, 2002 - v1
Checksum:i06B0BD771FEA284F
GO
Isoform 1 (identifier: Q8WTV0-2) [UniParc]FASTAAdd to Basket

Also known as: SR-BI

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:509
Mass (Da):56,973
Checksum:i0184AE9CEC595374
GO
Isoform 2 (identifier: Q8WTV0-3) [UniParc]FASTAAdd to Basket

Also known as: SR-BII

The sequence of this isoform differs from the canonical sequence as follows:
     43-142: Missing.
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:409
Mass (Da):45,103
Checksum:i88B30340CD403541
GO
Isoform 4 (identifier: Q8WTV0-4) [UniParc]FASTAAdd to Basket

Also known as: SR-BIII

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLK → MALQPSW
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:474
Mass (Da):53,579
Checksum:i1CF55DEB32EF3D3B
GO
Isoform 5 (identifier: Q8WTV0-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → GPEDTVSQPG...PSGQPPSPTA

Note: No experimental confirmation available. Gene prediction based on EST data.

Show »
Length:506
Mass (Da):56,170
Checksum:i73C1ED23924F2B49
GO

Polymorphismi

Genetic variations in SCARB1 define the high density lipoprotein cholesterol level quantitative trait locus 6 (HDLCQ16) [MIMi:610762].

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti2 – 21G → S Associated with higher plasma triglyceride concentration in subjects with hypercholesterolemia. 2 Publications
Corresponds to variant rs4238001 [ dbSNP | Ensembl ].
VAR_017098
Natural varianti135 – 1351V → I.1 Publication
Corresponds to variant rs5891 [ dbSNP | Ensembl ].
VAR_017099
Natural varianti167 – 1671G → S.1 Publication
Corresponds to variant rs199588922 [ dbSNP | Ensembl ].
VAR_017100
Natural varianti229 – 2291S → G.
Corresponds to variant rs10396213 [ dbSNP | Ensembl ].
VAR_019507
Natural varianti297 – 2971P → S Mutation carriers have increased HDL cholesterol levels and a reduction in cholesterol efflux from macrophages. 1 Publication
VAR_064909
Natural varianti511 – 5111C → R.
Corresponds to variant rs2293440 [ dbSNP | Ensembl ].
VAR_017101

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4242MGCSA…QQVLK → MALQPSW in isoform 4.
VSP_011037Add
BLAST
Alternative sequencei43 – 142100Missing in isoform 2.
VSP_008553Add
BLAST
Alternative sequencei468 – 55285VGAGQ…GGTGS → EKCYLFWSSSKKGSKDKEAI QAYSESLMTSAPKGSVLQEA KL in isoform 1, isoform 2 and isoform 4.
VSP_008554Add
BLAST
Alternative sequencei468 – 55285VGAGQ…GGTGS → GPEDTVSQPGLAAGPDRPPS PYTPLLPDSPSGQPPSPTA in isoform 5.
VSP_054083Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti70 – 701F → L in AAQ08185. 1 Publication
Sequence conflicti97 – 971F → S in CAA80277. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z22555 mRNA. Translation: CAA80277.1.
AF515445 mRNA. Translation: AAQ08185.1.
AC073593 Genomic DNA. No translation available.
AC126309 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW98459.1.
BC022087 mRNA. No translation available.
BC080647 mRNA. Translation: AAH80647.1.
BC093732 mRNA. Translation: AAH93732.1.
BC112037 mRNA. Translation: AAI12038.1.
CCDSiCCDS45008.1. [Q8WTV0-5]
CCDS9259.1. [Q8WTV0-2]
PIRiS36656. A48528.
RefSeqiNP_001076428.1. NM_001082959.1. [Q8WTV0-5]
NP_005496.4. NM_005505.4. [Q8WTV0-2]
UniGeneiHs.731377.

Genome annotation databases

EnsembliENST00000261693; ENSP00000261693; ENSG00000073060. [Q8WTV0-2]
ENST00000339570; ENSP00000343795; ENSG00000073060.
ENST00000376788; ENSP00000365984; ENSG00000073060. [Q8WTV0-3]
ENST00000415380; ENSP00000414979; ENSG00000073060. [Q8WTV0-1]
GeneIDi949.
KEGGihsa:949.
UCSCiuc001ugm.4. human. [Q8WTV0-2]
uc001ugo.4. human. [Q8WTV0-1]
uc031qke.1. human. [Q8WTV0-4]

Polymorphism databases

DMDMi37999904.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z22555 mRNA. Translation: CAA80277.1 .
AF515445 mRNA. Translation: AAQ08185.1 .
AC073593 Genomic DNA. No translation available.
AC126309 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW98459.1 .
BC022087 mRNA. No translation available.
BC080647 mRNA. Translation: AAH80647.1 .
BC093732 mRNA. Translation: AAH93732.1 .
BC112037 mRNA. Translation: AAI12038.1 .
CCDSi CCDS45008.1. [Q8WTV0-5 ]
CCDS9259.1. [Q8WTV0-2 ]
PIRi S36656. A48528.
RefSeqi NP_001076428.1. NM_001082959.1. [Q8WTV0-5 ]
NP_005496.4. NM_005505.4. [Q8WTV0-2 ]
UniGenei Hs.731377.

3D structure databases

ProteinModelPortali Q8WTV0.
SMRi Q8WTV0. Positions 51-434.
ModBasei Search...

Protein-protein interaction databases

BioGridi 107387. 7 interactions.
IntActi Q8WTV0. 6 interactions.
MINTi MINT-5001419.
STRINGi 9606.ENSP00000261693.

Chemistry

BindingDBi Q8WTV0.
ChEMBLi CHEMBL1914272.
DrugBanki DB00144. Phosphatidylserine.

Protein family/group databases

TCDBi 9.B.39.1.3. the long chain fatty acid translocase (lcfat) family.

PTM databases

PhosphoSitei Q8WTV0.

Polymorphism databases

DMDMi 37999904.

Proteomic databases

MaxQBi Q8WTV0.
PaxDbi Q8WTV0.
PRIDEi Q8WTV0.

Protocols and materials databases

DNASUi 949.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261693 ; ENSP00000261693 ; ENSG00000073060 . [Q8WTV0-2 ]
ENST00000339570 ; ENSP00000343795 ; ENSG00000073060 .
ENST00000376788 ; ENSP00000365984 ; ENSG00000073060 . [Q8WTV0-3 ]
ENST00000415380 ; ENSP00000414979 ; ENSG00000073060 . [Q8WTV0-1 ]
GeneIDi 949.
KEGGi hsa:949.
UCSCi uc001ugm.4. human. [Q8WTV0-2 ]
uc001ugo.4. human. [Q8WTV0-1 ]
uc031qke.1. human. [Q8WTV0-4 ]

Organism-specific databases

CTDi 949.
GeneCardsi GC12M125262.
HGNCi HGNC:1664. SCARB1.
MIMi 601040. gene.
610762. phenotype.
neXtProti NX_Q8WTV0.
PharmGKBi PA97.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG257244.
HOVERGENi HBG106577.
InParanoidi Q8WTV0.
KOi K13885.
OMAi DNDTVSF.
OrthoDBi EOG79SDWX.
PhylomeDBi Q8WTV0.
TreeFami TF317925.

Enzyme and pathway databases

Reactomei REACT_13621. HDL-mediated lipid transport.
REACT_163679. Scavenging by Class B Receptors.

Miscellaneous databases

ChiTaRSi SCARB1. human.
GeneWikii SCARB1.
GenomeRNAii 949.
NextBioi 3946.
PROi Q8WTV0.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8WTV0.
Bgeei Q8WTV0.
CleanExi HS_SCARB1.
Genevestigatori Q8WTV0.

Family and domain databases

InterProi IPR002159. CD36.
IPR005428. CD36_antigen.
[Graphical view ]
PANTHERi PTHR11923. PTHR11923. 1 hit.
Pfami PF01130. CD36. 1 hit.
[Graphical view ]
PRINTSi PR01610. CD36ANTIGEN.
PR01609. CD36FAMILY.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification, primary structure and distribution of CLA-1, a novel member of the CD36/LIMPII gene family."
    Calvo D., Vega M.
    J. Biol. Chem. 268:18929-18935(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Promyelocyte.
  2. Hirano K., Yamashita S., Matsuzawa Y.
    Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Liver, Prostate and Rhabdomyosarcoma.
  6. "The human scavenger receptor class B type I is a novel candidate receptor for the hepatitis C virus."
    Scarselli E., Ansuini H., Cerino R., Roccasecca R.M., Acali S., Filocamo G., Traboni C., Nicosia A., Cortese R., Vitelli A.
    EMBO J. 21:5017-5025(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  7. "Phosphatidylserine binding of class B scavenger receptor type I, a phagocytosis receptor of testicular Sertoli cells."
    Kawasaki Y., Nakagawa A., Nagaosa K., Shiratsuchi A., Nakanishi Y.
    J. Biol. Chem. 277:27559-27566(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION.
  8. "Cell entry of hepatitis C virus requires a set of co-receptors that include the CD81 tetraspanin and the SR-B1 scavenger receptor."
    Bartosch B., Vitelli A., Granier C., Goujon C., Dubuisson J., Pascale S., Scarselli E., Cortese R., Nicosia A., Cosset F.-L.
    J. Biol. Chem. 278:41624-41630(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HCV E1/E2 ENVELOPE HETERODIMER.
  9. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-102 AND ASN-330.
    Tissue: Liver.
  10. "Biological, clinical and population relevance of 95 loci for blood lipids."
    Teslovich T.M., Musunuru K., Smith A.V., Edmondson A.C., Stylianou I.M., Koseki M., Pirruccello J.P., Ripatti S., Chasman D.I., Willer C.J., Johansen C.T., Fouchier S.W., Isaacs A., Peloso G.M., Barbalic M., Ricketts S.L., Bis J.C., Aulchenko Y.S.
    , Thorleifsson G., Feitosa M.F., Chambers J., Orho-Melander M., Melander O., Johnson T., Li X., Guo X., Li M., Shin Cho Y., Jin Go M., Jin Kim Y., Lee J.Y., Park T., Kim K., Sim X., Twee-Hee Ong R., Croteau-Chonka D.C., Lange L.A., Smith J.D., Song K., Hua Zhao J., Yuan X., Luan J., Lamina C., Ziegler A., Zhang W., Zee R.Y., Wright A.F., Witteman J.C., Wilson J.F., Willemsen G., Wichmann H.E., Whitfield J.B., Waterworth D.M., Wareham N.J., Waeber G., Vollenweider P., Voight B.F., Vitart V., Uitterlinden A.G., Uda M., Tuomilehto J., Thompson J.R., Tanaka T., Surakka I., Stringham H.M., Spector T.D., Soranzo N., Smit J.H., Sinisalo J., Silander K., Sijbrands E.J., Scuteri A., Scott J., Schlessinger D., Sanna S., Salomaa V., Saharinen J., Sabatti C., Ruokonen A., Rudan I., Rose L.M., Roberts R., Rieder M., Psaty B.M., Pramstaller P.P., Pichler I., Perola M., Penninx B.W., Pedersen N.L., Pattaro C., Parker A.N., Pare G., Oostra B.A., O'Donnell C.J., Nieminen M.S., Nickerson D.A., Montgomery G.W., Meitinger T., McPherson R., McCarthy M.I., McArdle W., Masson D., Martin N.G., Marroni F., Mangino M., Magnusson P.K., Lucas G., Luben R., Loos R.J., Lokki M.L., Lettre G., Langenberg C., Launer L.J., Lakatta E.G., Laaksonen R., Kyvik K.O., Kronenberg F., Konig I.R., Khaw K.T., Kaprio J., Kaplan L.M., Johansson A., Jarvelin M.R., Janssens A.C., Ingelsson E., Igl W., Kees Hovingh G., Hottenga J.J., Hofman A., Hicks A.A., Hengstenberg C., Heid I.M., Hayward C., Havulinna A.S., Hastie N.D., Harris T.B., Haritunians T., Hall A.S., Gyllensten U., Guiducci C., Groop L.C., Gonzalez E., Gieger C., Freimer N.B., Ferrucci L., Erdmann J., Elliott P., Ejebe K.G., Doring A., Dominiczak A.F., Demissie S., Deloukas P., de Geus E.J., de Faire U., Crawford G., Collins F.S., Chen Y.D., Caulfield M.J., Campbell H., Burtt N.P., Bonnycastle L.L., Boomsma D.I., Boekholdt S.M., Bergman R.N., Barroso I., Bandinelli S., Ballantyne C.M., Assimes T.L., Quertermous T., Altshuler D., Seielstad M., Wong T.Y., Tai E.S., Feranil A.B., Kuzawa C.W., Adair L.S., Taylor H.A. Jr., Borecki I.B., Gabriel S.B., Wilson J.G., Holm H., Thorsteinsdottir U., Gudnason V., Krauss R.M., Mohlke K.L., Ordovas J.M., Munroe P.B., Kooner J.S., Tall A.R., Hegele R.A., Kastelein J.J., Schadt E.E., Rotter J.I., Boerwinkle E., Strachan D.P., Mooser V., Stefansson K., Reilly M.P., Samani N.J., Schunkert H., Cupples L.A., Sandhu M.S., Ridker P.M., Rader D.J., van Duijn C.M., Peltonen L., Abecasis G.R., Boehnke M., Kathiresan S.
    Nature 466:707-713(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN HDLCQ16.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "Polymorphisms at the SRBI locus are associated with lipoprotein levels in subjects with heterozygous familial hypercholesterolemia."
    Tai E.S., Adiconis X., Ordovas J.M., Carmena-Ramon R., Real J., Corella D., Ascaso J., Carmena R.
    Clin. Genet. 63:53-58(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT SER-2.
  13. "Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors."
    Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C.
    Hum. Mol. Genet. 12:2733-2743(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS SER-2; ILE-135 AND SER-167.
  14. Cited for: VARIANT SER-297, INVOLVEMENT IN HDLCQ16.

Entry informationi

Entry nameiSCRB1_HUMAN
AccessioniPrimary (citable) accession number: Q8WTV0
Secondary accession number(s): F8W8N0
, Q14016, Q52LZ5, Q6KFX4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: March 1, 2002
Last modified: September 3, 2014
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi