Q8WTV0 (SCRB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Scavenger receptor class B member 1 Short name=SRB1 Alternative name(s): CD36 and LIMPII analogous 1 Short name=CLA-1 CD36 antigen-like 1 Collagen type I receptor, thrombospondin receptor-like 1 SR-BI CD_antigen=CD36 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 552 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity. Receptor for hepatitis C virus glycoprotein E2. Binding between SCARB1 and E2 was found to be independent of the genotype of the viral isolate. Plays an important role in the uptake of HDL cholesteryl ester By similarity. Ref.5 |
| Subunit structure | Plays a critical role in HCV attachment and/or cell entry by interacting with HCV E1/E2 glycoproteins heterodimer. The C-terminal region binds to PDZK1 By similarity. |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Membrane › caveola; Multi-pass membrane protein. Note: Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae. |
| Tissue specificity | Widely expressed. |
| Post-translational modification | N-glycosylated. Ref.6 The six cysteines of the extracellular domain are all involved in intramolecular disulfide bonds By similarity. |
| Polymorphism | Genetic variations in SCARB1 define the high density lipoprotein cholesterol level quantitative trait locus 6 (HDLCQ16) [MIM:610762]. |
| Sequence similarities | Belongs to the CD36 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PRMT2 | P55345 | 1 | EBI-78657,EBI-78458 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: Q8WTV0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: May be due to a competing donor splice site. No experimental confirmation available. | ||||||
| Isoform 1 (identifier: Q8WTV0-2) Also known as: SR-BI; The sequence of this isoform differs from the canonical sequence as follows: 468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL | ||||||
| Isoform 2 (identifier: Q8WTV0-3) Also known as: SR-BII; The sequence of this isoform differs from the canonical sequence as follows: 43-142: Missing. 468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL | ||||||
| Isoform 4 (identifier: Q8WTV0-4) Also known as: SR-BIII; The sequence of this isoform differs from the canonical sequence as follows: 1-42: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLK → MALQPSW 468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 552 | 552 | Scavenger receptor class B member 1 | PRO_0000144160 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 11 | 11 | Cytoplasmic Potential | ||||||||
| Transmembrane | 12 – 32 | 21 | Helical; Potential | ||||||||
| Topological domain | 33 – 443 | 411 | Extracellular Potential | ||||||||
| Transmembrane | 444 – 464 | 21 | Helical; Potential | ||||||||
| Topological domain | 465 – 552 | 88 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Ref.8 | ||||||||
| Glycosylation | 108 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 173 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 212 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 227 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 255 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 310 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 330 | 1 | N-linked (GlcNAc...) Ref.8 | ||||||||
| Glycosylation | 383 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 251 ↔ 384 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 42 | 42 | MGCSA…QQVLK → MALQPSW in isoform 4. | VSP_011037 | |||||||
| Alternative sequence | 43 – 142 | 100 | Missing in isoform 2. | VSP_008553 | |||||||
| Alternative sequence | 468 – 552 | 85 | VGAGQ…GGTGS → EKCYLFWSSSKKGSKDKEAI QAYSESLMTSAPKGSVLQEA KL in isoform 1, isoform 2 and isoform 4. | VSP_008554 | |||||||
| Natural variant | 2 | 1 | G → S Associated with higher plasma triglyceride concentration in subjects with hypercholesterolemia. Ref.11 Ref.12 Corresponds to variant rs4238001 [ dbSNP | Ensembl ]. | VAR_017098 | |||||||
| Natural variant | 135 | 1 | V → I. Ref.12 Corresponds to variant rs5891 [ dbSNP | Ensembl ]. | VAR_017099 | |||||||
| Natural variant | 167 | 1 | G → S. Ref.12 | VAR_017100 | |||||||
| Natural variant | 229 | 1 | S → G. Corresponds to variant rs10396213 [ dbSNP | Ensembl ]. | VAR_019507 | |||||||
| Natural variant | 297 | 1 | P → S Mutation carriers have increased HDL cholesterol levels and a reduction in cholesterol efflux from macrophages. Ref.13 | VAR_064909 | |||||||
| Natural variant | 511 | 1 | C → R. Corresponds to variant rs2293440 [ dbSNP | Ensembl ]. | VAR_017101 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 70 | 1 | F → L in AAQ08185. Ref.2 | ||||||||
| Sequence conflict | 97 | 1 | F → S in CAA80277. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification, primary structure and distribution of CLA-1, a novel member of the CD36/LIMPII gene family." Calvo D., Vega M. J. Biol. Chem. 268:18929-18935(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Promyelocyte. |
| [2] | Hirano K., Yamashita S., Matsuzawa Y. Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Liver, Prostate and Rhabdomyosarcoma. |
| [5] | "The human scavenger receptor class B type I is a novel candidate receptor for the hepatitis C virus." Scarselli E., Ansuini H., Cerino R., Roccasecca R.M., Acali S., Filocamo G., Traboni C., Nicosia A., Cortese R., Vitelli A. EMBO J. 21:5017-5025(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [6] | "Phosphatidylserine binding of class B scavenger receptor type I, a phagocytosis receptor of testicular Sertoli cells." Kawasaki Y., Nakagawa A., Nagaosa K., Shiratsuchi A., Nakanishi Y. J. Biol. Chem. 277:27559-27566(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION. |
| [7] | "Cell entry of hepatitis C virus requires a set of co-receptors that include the CD81 tetraspanin and the SR-B1 scavenger receptor." Bartosch B., Vitelli A., Granier C., Goujon C., Dubuisson J., Pascale S., Scarselli E., Cortese R., Nicosia A., Cosset F.-L. J. Biol. Chem. 278:41624-41630(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HCV E1/E2 ENVELOPE HETERODIMER. |
| [8] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-102 AND ASN-330, MASS SPECTROMETRY. Tissue: Liver. |
| [9] | "Biological, clinical and population relevance of 95 loci for blood lipids." Teslovich T.M., Musunuru K., Smith A.V., Edmondson A.C., Stylianou I.M., Koseki M., Pirruccello J.P., Ripatti S., Chasman D.I., Willer C.J., Johansen C.T., Fouchier S.W., Isaacs A., Peloso G.M., Barbalic M., Ricketts S.L., Bis J.C., Aulchenko Y.S. Kathiresan S.Nature 466:707-713(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN HDLCQ16. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Polymorphisms at the SRBI locus are associated with lipoprotein levels in subjects with heterozygous familial hypercholesterolemia." Tai E.S., Adiconis X., Ordovas J.M., Carmena-Ramon R., Real J., Corella D., Ascaso J., Carmena R. Clin. Genet. 63:53-58(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SER-2. |
| [12] | "Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors." Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C. Hum. Mol. Genet. 12:2733-2743(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS SER-2; ILE-135 AND SER-167. |
| [13] | "Genetic variant of the scavenger receptor BI in humans." Vergeer M., Korporaal S.J., Franssen R., Meurs I., Out R., Hovingh G.K., Hoekstra M., Sierts J.A., Dallinga-Thie G.M., Motazacker M.M., Holleboom A.G., Van Berkel T.J., Kastelein J.J., Van Eck M., Kuivenhoven J.A. N. Engl. J. Med. 364:136-145(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SER-297, INVOLVEMENT IN HDLCQ16. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z22555 mRNA. Translation: CAA80277.1. AF515445 mRNA. Translation: AAQ08185.1. BC022087 mRNA. No translation available. CH471054 Genomic DNA. Translation: EAW98459.1. BC080647 mRNA. Translation: AAH80647.1. BC093732 mRNA. Translation: AAH93732.1. BC112037 mRNA. Translation: AAI12038.1. |
| IPI | IPI00177968. IPI00291007. IPI00375570. IPI00447020. |
| PIR | A48528. S36656. |
| RefSeq | NP_005496.4. NM_005505.4. |
| UniGene | Hs.731377. |
3D structure databases | |
| ProteinModelPortal | Q8WTV0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8WTV0. 2 interactions. |
| STRING | 9606.ENSP00000261693. |
PTM databases | |
| PhosphoSite | Q8WTV0. |
Polymorphism databases | |
| DMDM | 37999904. |
Proteomic databases | |
| PaxDb | Q8WTV0. |
| PRIDE | Q8WTV0. |
Protocols and materials databases | |
| DNASU | 949. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000261693; ENSP00000261693; ENSG00000073060. ENST00000376788; ENSP00000365984; ENSG00000073060. ENST00000415380; ENSP00000414979; ENSG00000073060. |
| GeneID | 949. |
| KEGG | hsa:949. |
| UCSC | uc001ugm.4. human. uc001ugo.4. human. |
Organism-specific databases | |
| CTD | 949. |
| GeneCards | GC12M125262. |
| HGNC | HGNC:1664. SCARB1. |
| MIM | 601040. gene. 610762. phenotype. |
| neXtProt | NX_Q8WTV0. |
| PharmGKB | PA97. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG257244. |
| HOVERGEN | HBG106577. |
| InParanoid | Q8WTV0. |
| KO | K13885. |
| OMA | PYVYREF. |
| OrthoDB | EOG4J3WGW. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| ArrayExpress | Q8WTV0. |
| Bgee | Q8WTV0. |
| CleanEx | HS_SCARB1. |
| Genevestigator | Q8WTV0. |
| GermOnline | ENSG00000073060. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002159. CD36. IPR005428. CD36_antigen. [Graphical view] |
| PANTHER | PTHR11923. PTHR11923. 1 hit. |
| Pfam | PF01130. CD36. 1 hit. [Graphical view] |
| PRINTS | PR01610. CD36ANTIGEN. PR01609. CD36FAMILY. |
| ProtoNet | Search... |
Other | |
| BindingDB | Q8WTV0. |
| ChEMBL | CHEMBL1914272. |
| ChiTaRS | SCARB1. human. |
| DrugBank | DB00144. Phosphatidylserine. |
| GenomeRNAi | 949. |
| NextBio | 3946. |
| SOURCE | Search... |
Entry information
| Entry name | SCRB1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8WTV0 Secondary accession number(s): Q14016, Q52LZ5, Q6KFX4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
