Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Scavenger receptor class B member 1

Gene

SCARB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells (PubMed:12016218, PubMed:12519372, PubMed:21226579). Receptor for HDL, mediating selective uptake of cholesteryl ether and HDL-dependent cholesterol efflux (PubMed:26965621). Also facilitates the flux of free and esterified cholesterol between the cell surface and apoB-containing lipoproteins and modified lipoproteins, although less efficiently than HDL. May be involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity (PubMed:12016218).5 Publications
(Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes and appears to facilitate its cell entry (PubMed:12356718, PubMed:12913001, PubMed:18000990). Binding between SCARB1 and the hepatitis C virus glycoprotein E2 is independent of the genotype of the viral isolate (PubMed:12356718). Mediates uptake of M.fortuitum, E.coli and S.aureus (PubMed:16020694).3 Publications

GO - Molecular functioni

  • 1-phosphatidylinositol binding Source: BHF-UCL
  • amyloid-beta binding Source: Ensembl
  • apolipoprotein A-I binding Source: BHF-UCL
  • apolipoprotein binding Source: BHF-UCL
  • high-density lipoprotein particle binding Source: Ensembl
  • high-density lipoprotein particle receptor activity Source: BHF-UCL
  • lipopolysaccharide binding Source: BHF-UCL
  • lipopolysaccharide receptor activity Source: BHF-UCL
  • low-density lipoprotein particle binding Source: BHF-UCL
  • phosphatidylserine binding Source: BHF-UCL
  • protein homodimerization activity Source: Ensembl
  • scavenger receptor activity Source: ARUK-UCL
  • transporter activity Source: ProtInc
  • virus receptor activity Source: UniProtKB-KW

GO - Biological processi

  • adhesion of symbiont to host Source: BHF-UCL
  • androgen biosynthetic process Source: Ensembl
  • blood vessel endothelial cell migration Source: Ensembl
  • cholesterol catabolic process Source: Ensembl
  • cholesterol efflux Source: AgBase
  • cholesterol homeostasis Source: BHF-UCL
  • cholesterol import Source: UniProtKB
  • detection of lipopolysaccharide Source: BHF-UCL
  • endothelial cell proliferation Source: Ensembl
  • high-density lipoprotein particle clearance Source: BHF-UCL
  • high-density lipoprotein particle remodeling Source: BHF-UCL
  • intestinal absorption Source: Ensembl
  • lipopolysaccharide transport Source: BHF-UCL
  • low-density lipoprotein particle clearance Source: BHF-UCL
  • phospholipid transport Source: BHF-UCL
  • positive regulation of cholesterol storage Source: BHF-UCL
  • positive regulation of endothelial cell migration Source: BHF-UCL
  • positive regulation of nitric-oxide synthase activity Source: BHF-UCL
  • positive regulation of triglyceride biosynthetic process Source: BHF-UCL
  • receptor-mediated endocytosis Source: Reactome
  • recognition of apoptotic cell Source: BHF-UCL
  • regulation of phagocytosis Source: BHF-UCL
  • regulation of phosphatidylcholine catabolic process Source: BHF-UCL
  • reverse cholesterol transport Source: BHF-UCL
  • triglyceride homeostasis Source: BHF-UCL
  • vitamin transmembrane transport Source: AgBase
  • wound healing Source: BHF-UCL

Keywordsi

Molecular functionHost cell receptor for virus entry, Receptor
Biological processHost-virus interaction

Enzyme and pathway databases

ReactomeiR-HSA-3000471 Scavenging by Class B Receptors
R-HSA-8964011 HDL clearance

Protein family/group databases

TCDBi9.B.39.1.3 the long chain fatty acid translocase (lcfat) family

Chemistry databases

SwissLipidsiSLP:000001519

Names & Taxonomyi

Protein namesi
Recommended name:
Scavenger receptor class B member 1
Short name:
SRB1
Alternative name(s):
CD36 and LIMPII analogous 1
Short name:
CLA-1
CD36 antigen-like 1
Collagen type I receptor, thrombospondin receptor-like 1
SR-BI
CD_antigen: CD36
Gene namesi
Name:SCARB1
Synonyms:CD36L1, CLA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000073060.15
HGNCiHGNC:1664 SCARB1
MIMi601040 gene
neXtProtiNX_Q8WTV0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 11CytoplasmicSequence analysisAdd BLAST11
Transmembranei12 – 32HelicalSequence analysisAdd BLAST21
Topological domaini33 – 443ExtracellularSequence analysisAdd BLAST411
Transmembranei444 – 464HelicalSequence analysisAdd BLAST21
Topological domaini465 – 552CytoplasmicSequence analysisAdd BLAST88

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi949
MalaCardsiSCARB1
MIMi610762 phenotype
OpenTargetsiENSG00000073060
PharmGKBiPA97

Chemistry databases

ChEMBLiCHEMBL1914272
DrugBankiDB00144 Phosphatidyl serine

Polymorphism and mutation databases

BioMutaiSCARB1
DMDMi37999904

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001441601 – 552Scavenger receptor class B member 1Add BLAST552

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi102N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi108N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi173N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi212N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi227N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi251 ↔ 384By similarity
Glycosylationi255N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi310N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi330N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi383N-linked (GlcNAc...) asparagineSequence analysis1
Lipidationi462S-palmitoyl cysteineBy similarity1
Isoform 2 (identifier: Q8WTV0-3)
Modified residuei393PhosphoserineCombined sources1
Isoform 4 (identifier: Q8WTV0-4)
Modified residuei458PhosphoserineCombined sources1
Isoform 1 (identifier: Q8WTV0-2)
Modified residuei493PhosphoserineCombined sources1

Post-translational modificationi

N-glycosylated.2 Publications
The six cysteines of the extracellular domain are all involved in intramolecular disulfide bonds.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDiQ8WTV0
MaxQBiQ8WTV0
PaxDbiQ8WTV0
PeptideAtlasiQ8WTV0
PRIDEiQ8WTV0

PTM databases

iPTMnetiQ8WTV0
PhosphoSitePlusiQ8WTV0
SwissPalmiQ8WTV0

Expressioni

Tissue specificityi

Widely expressed.

Gene expression databases

BgeeiENSG00000073060
CleanExiHS_SCARB1
ExpressionAtlasiQ8WTV0 baseline and differential
GenevisibleiQ8WTV0 HS

Organism-specific databases

HPAiCAB070124
HPA066285

Interactioni

Subunit structurei

The C-terminal region binds to PDZK1.By similarity
(Microbial infection) Interacts with hepatitis C virus E1:E2 glycoproteins.1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • apolipoprotein A-I binding Source: BHF-UCL
  • apolipoprotein binding Source: BHF-UCL
  • protein homodimerization activity Source: Ensembl

Protein-protein interaction databases

BioGridi107387, 31 interactors
IntActiQ8WTV0, 11 interactors
STRINGi9606.ENSP00000261693

Chemistry databases

BindingDBiQ8WTV0

Structurei

3D structure databases

ProteinModelPortaliQ8WTV0
SMRiQ8WTV0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CD36 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3776 Eukaryota
ENOG410XS17 LUCA
GeneTreeiENSGT00530000062927
HOVERGENiHBG106577
InParanoidiQ8WTV0
KOiK13885
OMAiSQEKCYL
OrthoDBiEOG091G0CH9
PhylomeDBiQ8WTV0
TreeFamiTF317925

Family and domain databases

InterProiView protein in InterPro
IPR005428 CD36/SCARB1/SNMP1
IPR002159 CD36_fam
PANTHERiPTHR11923 PTHR11923, 1 hit
PfamiView protein in Pfam
PF01130 CD36, 1 hit
PRINTSiPR01610 CD36ANTIGEN
PR01609 CD36FAMILY

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q8WTV0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCSAKARWA AGALGVAGLL CAVLGAVMIV MVPSLIKQQV LKNVRIDPSS
60 70 80 90 100
LSFNMWKEIP IPFYLSVYFF DVMNPSEILK GEKPQVRERG PYVYREFRHK
110 120 130 140 150
SNITFNNNDT VSFLEYRTFQ FQPSKSHGSE SDYIVMPNIL VLGAAVMMEN
160 170 180 190 200
KPMTLKLIMT LAFTTLGERA FMNRTVGEIM WGYKDPLVNL INKYFPGMFP
210 220 230 240 250
FKDKFGLFAE LNNSDSGLFT VFTGVQNISR IHLVDKWNGL SKVDFWHSDQ
260 270 280 290 300
CNMINGTSGQ MWPPFMTPES SLEFYSPEAC RSMKLMYKES GVFEGIPTYR
310 320 330 340 350
FVAPKTLFAN GSIYPPNEGF CPCLESGIQN VSTCRFSAPL FLSHPHFLNA
360 370 380 390 400
DPVLAEAVTG LHPNQEAHSL FLDIHPVTGI PMNCSVKLQL SLYMKSVAGI
410 420 430 440 450
GQTGKIEPVV LPLLWFAESG AMEGETLHTF YTQLVLMPKV MHYAQYVLLA
460 470 480 490 500
LGCVLLLVPV ICQIRSQVGA GQRAARADSH SLACWGKGAS DRTLWPTAAW
510 520 530 540 550
SPPPAAVLRL CRSGSGHCWG LRSTLASFAC RVATTLPVLE GLGPSLGGGT

GS
Note: May be due to a competing donor splice site. No experimental confirmation available.
Length:552
Mass (Da):60,878
Last modified:March 1, 2002 - v1
Checksum:i06B0BD771FEA284F
GO
Isoform 1 (identifier: Q8WTV0-2) [UniParc]FASTAAdd to basket
Also known as: SR-BI

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:509
Mass (Da):56,973
Checksum:i0184AE9CEC595374
GO
Isoform 2 (identifier: Q8WTV0-3) [UniParc]FASTAAdd to basket
Also known as: SR-BII

The sequence of this isoform differs from the canonical sequence as follows:
     43-142: Missing.
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:409
Mass (Da):45,103
Checksum:i88B30340CD403541
GO
Isoform 4 (identifier: Q8WTV0-4) [UniParc]FASTAAdd to basket
Also known as: SR-BIII

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLK → MALQPSW
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

Show »
Length:474
Mass (Da):53,579
Checksum:i1CF55DEB32EF3D3B
GO
Isoform 5 (identifier: Q8WTV0-5) [UniParc]FASTAAdd to basket
Also known as: SR-BI.21 Publication, SR-BII1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → GPEDTVSQPG...PSGQPPSPTA

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:506
Mass (Da):56,170
Checksum:i73C1ED23924F2B49
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti70F → L in AAQ08185 (Ref. 2) Curated1
Sequence conflicti97F → S in CAA80277 (PubMed:7689561).Curated1

Polymorphismi

Genetic variations in SCARB1 define the high density lipoprotein cholesterol level quantitative trait locus 6 (HDLCQ16) [MIMi:610762].3 Publications

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0170982G → S Associated with higher plasma triglyceride concentration in subjects with hypercholesterolemia. 2 PublicationsCorresponds to variant dbSNP:rs4238001Ensembl.1
Natural variantiVAR_017099135V → I1 PublicationCorresponds to variant dbSNP:rs5891Ensembl.1
Natural variantiVAR_017100167G → S1 PublicationCorresponds to variant dbSNP:rs199588922Ensembl.1
Natural variantiVAR_019507229S → G. Corresponds to variant dbSNP:rs10396213Ensembl.1
Natural variantiVAR_064909297P → S Mutation carriers have increased HDL cholesterol levels and a reduction in cholesterol efflux from macrophages. 1 PublicationCorresponds to variant dbSNP:rs387906791EnsemblClinVar.1
Natural variantiVAR_076314376P → L Rare variant; associated with high HDL-cholesterol levels and increased risk for coronary heart disease; results in highly reduced cholesterol uptake from HDL; markedly reduced localization at the cell surface. 1 PublicationCorresponds to variant dbSNP:rs74830677EnsemblClinVar.1
Natural variantiVAR_017101511C → R. Corresponds to variant dbSNP:rs2293440Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0110371 – 42MGCSA…QQVLK → MALQPSW in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_00855343 – 142Missing in isoform 2. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_008554468 – 552VGAGQ…GGTGS → EKCYLFWSSSKKGSKDKEAI QAYSESLMTSAPKGSVLQEA KL in isoform 1, isoform 2 and isoform 4. 3 PublicationsAdd BLAST85
Alternative sequenceiVSP_054083468 – 552VGAGQ…GGTGS → GPEDTVSQPGLAAGPDRPPS PYTPLLPDSPSGQPPSPTA in isoform 5. CuratedAdd BLAST85

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z22555 mRNA Translation: CAA80277.1
AF515445 mRNA Translation: AAQ08185.1
AC073593 Genomic DNA No translation available.
AC126309 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW98459.1
BC022087 mRNA No translation available.
BC080647 mRNA Translation: AAH80647.1
BC093732 mRNA Translation: AAH93732.1
BC112037 mRNA Translation: AAI12038.1
CCDSiCCDS45008.1 [Q8WTV0-5]
CCDS9259.1 [Q8WTV0-2]
PIRiS36656 A48528
RefSeqiNP_001076428.1, NM_001082959.1 [Q8WTV0-5]
NP_005496.4, NM_005505.4 [Q8WTV0-2]
UniGeneiHs.731377

Genome annotation databases

EnsembliENST00000261693; ENSP00000261693; ENSG00000073060 [Q8WTV0-2]
ENST00000339570; ENSP00000343795; ENSG00000073060 [Q8WTV0-5]
ENST00000415380; ENSP00000414979; ENSG00000073060 [Q8WTV0-1]
GeneIDi949
KEGGihsa:949
UCSCiuc001ugm.5 human [Q8WTV0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSCRB1_HUMAN
AccessioniPrimary (citable) accession number: Q8WTV0
Secondary accession number(s): F8W8N0
, Q14016, Q52LZ5, Q6KFX4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: March 1, 2002
Last modified: May 23, 2018
This is version 163 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health