Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8WTV0 (SCRB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 126. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Scavenger receptor class B member 1

Short name=SRB1
Alternative name(s):
CD36 and LIMPII analogous 1
Short name=CLA-1
CD36 antigen-like 1
Collagen type I receptor, thrombospondin receptor-like 1
SR-BI
CD_antigen=CD36
Gene names
Name:SCARB1
Synonyms:CD36L1, CLA1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length552 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity. Receptor for hepatitis C virus glycoprotein E2. Binding between SCARB1 and E2 was found to be independent of the genotype of the viral isolate. Plays an important role in the uptake of HDL cholesteryl ester By similarity. Ref.6

Subunit structure

Plays a critical role in HCV attachment and/or cell entry by interacting with HCV E1/E2 glycoproteins heterodimer. The C-terminal region binds to PDZK1 By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein. Membranecaveola; Multi-pass membrane protein. Note: Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae.

Tissue specificity

Widely expressed.

Post-translational modification

N-glycosylated. Ref.7

The six cysteines of the extracellular domain are all involved in intramolecular disulfide bonds By similarity.

Polymorphism

Genetic variations in SCARB1 define the high density lipoprotein cholesterol level quantitative trait locus 6 (HDLCQ16) [MIM:610762].

Sequence similarities

Belongs to the CD36 family.

Ontologies

Keywords
   Biological processHost-virus interaction
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processadhesion of symbiont to host

Inferred from mutant phenotype PubMed 19087225. Source: BHF-UCL

androgen biosynthetic process

Inferred from electronic annotation. Source: Ensembl

blood vessel endothelial cell migration

Inferred from electronic annotation. Source: Ensembl

cell adhesion

Inferred from electronic annotation. Source: InterPro

cholesterol catabolic process

Inferred from electronic annotation. Source: Ensembl

cholesterol efflux

Inferred from sequence or structural similarity PubMed 14718538. Source: BHF-UCL

cholesterol homeostasis

Inferred from sequence or structural similarity. Source: BHF-UCL

cholesterol import

Inferred from sequence or structural similarity PubMed 14718538. Source: BHF-UCL

detection of lipopolysaccharide

Inferred from direct assay PubMed 12651854. Source: BHF-UCL

endothelial cell proliferation

Inferred from electronic annotation. Source: Ensembl

high-density lipoprotein particle clearance

Inferred from direct assay PubMed 9211901. Source: BHF-UCL

high-density lipoprotein particle remodeling

Inferred from sequence or structural similarity. Source: BHF-UCL

lipopolysaccharide transport

Inferred from direct assay PubMed 12651854. Source: BHF-UCL

lipopolysaccharide-mediated signaling pathway

Inferred from direct assay PubMed 12651854. Source: GOC

lipoprotein metabolic process

Traceable author statement. Source: Reactome

low-density lipoprotein particle clearance

Inferred from sequence or structural similarity. Source: BHF-UCL

phospholipid transport

Inferred from sequence or structural similarity. Source: BHF-UCL

positive regulation of cholesterol storage

Inferred from direct assay PubMed 9211901. Source: BHF-UCL

positive regulation of endothelial cell migration

Traceable author statement PubMed 17574123. Source: BHF-UCL

positive regulation of nitric-oxide synthase activity

Inferred from direct assay PubMed 11792700. Source: BHF-UCL

positive regulation of triglyceride biosynthetic process

Inferred from sequence or structural similarity. Source: BHF-UCL

receptor-mediated endocytosis

Inferred from direct assay PubMed 9211901. Source: GOC

recognition of apoptotic cell

Inferred from direct assay PubMed 9211901. Source: BHF-UCL

regulation of phagocytosis

Inferred by curator PubMed 9211901. Source: BHF-UCL

regulation of phosphatidylcholine catabolic process

Inferred from sequence or structural similarity. Source: BHF-UCL

reverse cholesterol transport

Inferred from expression pattern PubMed 9211901. Source: BHF-UCL

small molecule metabolic process

Traceable author statement. Source: Reactome

triglyceride homeostasis

Inferred from sequence or structural similarity. Source: BHF-UCL

viral process

Inferred from electronic annotation. Source: UniProtKB-KW

wound healing

Traceable author statement PubMed 17574123. Source: BHF-UCL

   Cellular_componentcaveola

Traceable author statement PubMed 12651854. Source: BHF-UCL

cell surface

Inferred from electronic annotation. Source: Ensembl

endocytic vesicle membrane

Traceable author statement. Source: Reactome

extracellular vesicular exosome

Inferred from direct assay PubMed 20458337. Source: UniProt

integral component of plasma membrane

Inferred from electronic annotation. Source: Ensembl

lysosomal membrane

Inferred from direct assay PubMed 17897319. Source: UniProtKB

microvillus membrane

Inferred from electronic annotation. Source: Ensembl

plasma membrane

Inferred from direct assay PubMed 9211901. Source: BHF-UCL

   Molecular_function1-phosphatidylinositol binding

Traceable author statement PubMed 9211901. Source: BHF-UCL

apolipoprotein A-I binding

Inferred from physical interaction PubMed 10764676PubMed 12651854. Source: BHF-UCL

apolipoprotein binding

Inferred from physical interaction PubMed 10764676. Source: BHF-UCL

high-density lipoprotein particle binding

Inferred from electronic annotation. Source: Ensembl

high-density lipoprotein particle receptor activity

Inferred from direct assay PubMed 9211901. Source: BHF-UCL

lipopolysaccharide binding

Inferred from direct assay PubMed 12651854. Source: BHF-UCL

lipopolysaccharide receptor activity

Inferred from direct assay PubMed 12651854. Source: BHF-UCL

low-density lipoprotein particle binding

Inferred from direct assay PubMed 9211901. Source: BHF-UCL

phosphatidylserine binding

Inferred from sequence or structural similarity. Source: BHF-UCL

protein binding

Inferred from physical interaction Ref.6. Source: IntAct

transporter activity

Traceable author statement PubMed 9211901. Source: ProtInc

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

P279582EBI-78657,EBI-6904269From a different organism.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 3 (identifier: Q8WTV0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: May be due to a competing donor splice site. No experimental confirmation available.
Isoform 1 (identifier: Q8WTV0-2)

Also known as: SR-BI;

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL
Isoform 2 (identifier: Q8WTV0-3)

Also known as: SR-BII;

The sequence of this isoform differs from the canonical sequence as follows:
     43-142: Missing.
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL
Isoform 4 (identifier: Q8WTV0-4)

Also known as: SR-BIII;

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLK → MALQPSW
     468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL
Isoform 5 (identifier: Q8WTV0-5)

The sequence of this isoform differs from the canonical sequence as follows:
     468-552: VGAGQRAARA...GPSLGGGTGS → GPEDTVSQPG...PSGQPPSPTA
Note: No experimental confirmation available. Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 552552Scavenger receptor class B member 1
PRO_0000144160

Regions

Topological domain1 – 1111Cytoplasmic Potential
Transmembrane12 – 3221Helical; Potential
Topological domain33 – 443411Extracellular Potential
Transmembrane444 – 46421Helical; Potential
Topological domain465 – 55288Cytoplasmic Potential

Amino acid modifications

Glycosylation1021N-linked (GlcNAc...) Ref.9
Glycosylation1081N-linked (GlcNAc...) Potential
Glycosylation1731N-linked (GlcNAc...) Potential
Glycosylation2121N-linked (GlcNAc...) Potential
Glycosylation2271N-linked (GlcNAc...) Potential
Glycosylation2551N-linked (GlcNAc...) Potential
Glycosylation3101N-linked (GlcNAc...) Potential
Glycosylation3301N-linked (GlcNAc...) Ref.9
Glycosylation3831N-linked (GlcNAc...) Potential
Disulfide bond251 ↔ 384 By similarity

Natural variations

Alternative sequence1 – 4242MGCSA…QQVLK → MALQPSW in isoform 4.
VSP_011037
Alternative sequence43 – 142100Missing in isoform 2.
VSP_008553
Alternative sequence468 – 55285VGAGQ…GGTGS → EKCYLFWSSSKKGSKDKEAI QAYSESLMTSAPKGSVLQEA KL in isoform 1, isoform 2 and isoform 4.
VSP_008554
Alternative sequence468 – 55285VGAGQ…GGTGS → GPEDTVSQPGLAAGPDRPPS PYTPLLPDSPSGQPPSPTA in isoform 5.
VSP_054083
Natural variant21G → S Associated with higher plasma triglyceride concentration in subjects with hypercholesterolemia. Ref.12 Ref.13
Corresponds to variant rs4238001 [ dbSNP | Ensembl ].
VAR_017098
Natural variant1351V → I. Ref.13
Corresponds to variant rs5891 [ dbSNP | Ensembl ].
VAR_017099
Natural variant1671G → S. Ref.13
Corresponds to variant rs199588922 [ dbSNP | Ensembl ].
VAR_017100
Natural variant2291S → G.
Corresponds to variant rs10396213 [ dbSNP | Ensembl ].
VAR_019507
Natural variant2971P → S Mutation carriers have increased HDL cholesterol levels and a reduction in cholesterol efflux from macrophages. Ref.14
VAR_064909
Natural variant5111C → R.
Corresponds to variant rs2293440 [ dbSNP | Ensembl ].
VAR_017101

Experimental info

Sequence conflict701F → L in AAQ08185. Ref.2
Sequence conflict971F → S in CAA80277. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 3 [UniParc].

Last modified March 1, 2002. Version 1.
Checksum: 06B0BD771FEA284F

FASTA55260,878
        10         20         30         40         50         60 
MGCSAKARWA AGALGVAGLL CAVLGAVMIV MVPSLIKQQV LKNVRIDPSS LSFNMWKEIP 

        70         80         90        100        110        120 
IPFYLSVYFF DVMNPSEILK GEKPQVRERG PYVYREFRHK SNITFNNNDT VSFLEYRTFQ 

       130        140        150        160        170        180 
FQPSKSHGSE SDYIVMPNIL VLGAAVMMEN KPMTLKLIMT LAFTTLGERA FMNRTVGEIM 

       190        200        210        220        230        240 
WGYKDPLVNL INKYFPGMFP FKDKFGLFAE LNNSDSGLFT VFTGVQNISR IHLVDKWNGL 

       250        260        270        280        290        300 
SKVDFWHSDQ CNMINGTSGQ MWPPFMTPES SLEFYSPEAC RSMKLMYKES GVFEGIPTYR 

       310        320        330        340        350        360 
FVAPKTLFAN GSIYPPNEGF CPCLESGIQN VSTCRFSAPL FLSHPHFLNA DPVLAEAVTG 

       370        380        390        400        410        420 
LHPNQEAHSL FLDIHPVTGI PMNCSVKLQL SLYMKSVAGI GQTGKIEPVV LPLLWFAESG 

       430        440        450        460        470        480 
AMEGETLHTF YTQLVLMPKV MHYAQYVLLA LGCVLLLVPV ICQIRSQVGA GQRAARADSH 

       490        500        510        520        530        540 
SLACWGKGAS DRTLWPTAAW SPPPAAVLRL CRSGSGHCWG LRSTLASFAC RVATTLPVLE 

       550 
GLGPSLGGGT GS 

« Hide

Isoform 1 (SR-BI) [UniParc].

Checksum: 0184AE9CEC595374
Show »

FASTA50956,973
Isoform 2 (SR-BII) [UniParc].

Checksum: 88B30340CD403541
Show »

FASTA40945,103
Isoform 4 (SR-BIII) [UniParc].

Checksum: 1CF55DEB32EF3D3B
Show »

FASTA47453,579
Isoform 5 [UniParc].

Checksum: 73C1ED23924F2B49
Show »

FASTA50656,170

References

« Hide 'large scale' references
[1]"Identification, primary structure and distribution of CLA-1, a novel member of the CD36/LIMPII gene family."
Calvo D., Vega M.
J. Biol. Chem. 268:18929-18935(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Tissue: Promyelocyte.
[2]Hirano K., Yamashita S., Matsuzawa Y.
Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
[3]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Liver, Prostate and Rhabdomyosarcoma.
[6]"The human scavenger receptor class B type I is a novel candidate receptor for the hepatitis C virus."
Scarselli E., Ansuini H., Cerino R., Roccasecca R.M., Acali S., Filocamo G., Traboni C., Nicosia A., Cortese R., Vitelli A.
EMBO J. 21:5017-5025(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[7]"Phosphatidylserine binding of class B scavenger receptor type I, a phagocytosis receptor of testicular Sertoli cells."
Kawasaki Y., Nakagawa A., Nagaosa K., Shiratsuchi A., Nakanishi Y.
J. Biol. Chem. 277:27559-27566(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION.
[8]"Cell entry of hepatitis C virus requires a set of co-receptors that include the CD81 tetraspanin and the SR-B1 scavenger receptor."
Bartosch B., Vitelli A., Granier C., Goujon C., Dubuisson J., Pascale S., Scarselli E., Cortese R., Nicosia A., Cosset F.-L.
J. Biol. Chem. 278:41624-41630(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH HCV E1/E2 ENVELOPE HETERODIMER.
[9]"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-102 AND ASN-330.
Tissue: Liver.
[10]"Biological, clinical and population relevance of 95 loci for blood lipids."
Teslovich T.M., Musunuru K., Smith A.V., Edmondson A.C., Stylianou I.M., Koseki M., Pirruccello J.P., Ripatti S., Chasman D.I., Willer C.J., Johansen C.T., Fouchier S.W., Isaacs A., Peloso G.M., Barbalic M., Ricketts S.L., Bis J.C., Aulchenko Y.S. expand/collapse author list , Thorleifsson G., Feitosa M.F., Chambers J., Orho-Melander M., Melander O., Johnson T., Li X., Guo X., Li M., Shin Cho Y., Jin Go M., Jin Kim Y., Lee J.Y., Park T., Kim K., Sim X., Twee-Hee Ong R., Croteau-Chonka D.C., Lange L.A., Smith J.D., Song K., Hua Zhao J., Yuan X., Luan J., Lamina C., Ziegler A., Zhang W., Zee R.Y., Wright A.F., Witteman J.C., Wilson J.F., Willemsen G., Wichmann H.E., Whitfield J.B., Waterworth D.M., Wareham N.J., Waeber G., Vollenweider P., Voight B.F., Vitart V., Uitterlinden A.G., Uda M., Tuomilehto J., Thompson J.R., Tanaka T., Surakka I., Stringham H.M., Spector T.D., Soranzo N., Smit J.H., Sinisalo J., Silander K., Sijbrands E.J., Scuteri A., Scott J., Schlessinger D., Sanna S., Salomaa V., Saharinen J., Sabatti C., Ruokonen A., Rudan I., Rose L.M., Roberts R., Rieder M., Psaty B.M., Pramstaller P.P., Pichler I., Perola M., Penninx B.W., Pedersen N.L., Pattaro C., Parker A.N., Pare G., Oostra B.A., O'Donnell C.J., Nieminen M.S., Nickerson D.A., Montgomery G.W., Meitinger T., McPherson R., McCarthy M.I., McArdle W., Masson D., Martin N.G., Marroni F., Mangino M., Magnusson P.K., Lucas G., Luben R., Loos R.J., Lokki M.L., Lettre G., Langenberg C., Launer L.J., Lakatta E.G., Laaksonen R., Kyvik K.O., Kronenberg F., Konig I.R., Khaw K.T., Kaprio J., Kaplan L.M., Johansson A., Jarvelin M.R., Janssens A.C., Ingelsson E., Igl W., Kees Hovingh G., Hottenga J.J., Hofman A., Hicks A.A., Hengstenberg C., Heid I.M., Hayward C., Havulinna A.S., Hastie N.D., Harris T.B., Haritunians T., Hall A.S., Gyllensten U., Guiducci C., Groop L.C., Gonzalez E., Gieger C., Freimer N.B., Ferrucci L., Erdmann J., Elliott P., Ejebe K.G., Doring A., Dominiczak A.F., Demissie S., Deloukas P., de Geus E.J., de Faire U., Crawford G., Collins F.S., Chen Y.D., Caulfield M.J., Campbell H., Burtt N.P., Bonnycastle L.L., Boomsma D.I., Boekholdt S.M., Bergman R.N., Barroso I., Bandinelli S., Ballantyne C.M., Assimes T.L., Quertermous T., Altshuler D., Seielstad M., Wong T.Y., Tai E.S., Feranil A.B., Kuzawa C.W., Adair L.S., Taylor H.A. Jr., Borecki I.B., Gabriel S.B., Wilson J.G., Holm H., Thorsteinsdottir U., Gudnason V., Krauss R.M., Mohlke K.L., Ordovas J.M., Munroe P.B., Kooner J.S., Tall A.R., Hegele R.A., Kastelein J.J., Schadt E.E., Rotter J.I., Boerwinkle E., Strachan D.P., Mooser V., Stefansson K., Reilly M.P., Samani N.J., Schunkert H., Cupples L.A., Sandhu M.S., Ridker P.M., Rader D.J., van Duijn C.M., Peltonen L., Abecasis G.R., Boehnke M., Kathiresan S.
Nature 466:707-713(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN HDLCQ16.
[11]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[12]"Polymorphisms at the SRBI locus are associated with lipoprotein levels in subjects with heterozygous familial hypercholesterolemia."
Tai E.S., Adiconis X., Ordovas J.M., Carmena-Ramon R., Real J., Corella D., Ascaso J., Carmena R.
Clin. Genet. 63:53-58(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT SER-2.
[13]"Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors."
Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C.
Hum. Mol. Genet. 12:2733-2743(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS SER-2; ILE-135 AND SER-167.
[14]"Genetic variant of the scavenger receptor BI in humans."
Vergeer M., Korporaal S.J., Franssen R., Meurs I., Out R., Hovingh G.K., Hoekstra M., Sierts J.A., Dallinga-Thie G.M., Motazacker M.M., Holleboom A.G., Van Berkel T.J., Kastelein J.J., Van Eck M., Kuivenhoven J.A.
N. Engl. J. Med. 364:136-145(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT SER-297, INVOLVEMENT IN HDLCQ16.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Z22555 mRNA. Translation: CAA80277.1.
AF515445 mRNA. Translation: AAQ08185.1.
AC073593 Genomic DNA. No translation available.
AC126309 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW98459.1.
BC022087 mRNA. No translation available.
BC080647 mRNA. Translation: AAH80647.1.
BC093732 mRNA. Translation: AAH93732.1.
BC112037 mRNA. Translation: AAI12038.1.
CCDSCCDS9259.1. [Q8WTV0-2]
PIRA48528. S36656.
RefSeqNP_001076428.1. NM_001082959.1. [Q8WTV0-5]
NP_005496.4. NM_005505.4. [Q8WTV0-2]
UniGeneHs.731377.

3D structure databases

ProteinModelPortalQ8WTV0.
SMRQ8WTV0. Positions 51-434.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107387. 7 interactions.
IntActQ8WTV0. 6 interactions.
MINTMINT-5001419.
STRING9606.ENSP00000261693.

Chemistry

BindingDBQ8WTV0.
ChEMBLCHEMBL1914272.
DrugBankDB00144. Phosphatidylserine.

Protein family/group databases

TCDB9.B.39.1.3. the long chain fatty acid translocase (lcfat) family.

PTM databases

PhosphoSiteQ8WTV0.

Polymorphism databases

DMDM37999904.

Proteomic databases

MaxQBQ8WTV0.
PaxDbQ8WTV0.
PRIDEQ8WTV0.

Protocols and materials databases

DNASU949.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000261693; ENSP00000261693; ENSG00000073060. [Q8WTV0-2]
ENST00000339570; ENSP00000343795; ENSG00000073060.
ENST00000376788; ENSP00000365984; ENSG00000073060. [Q8WTV0-3]
ENST00000415380; ENSP00000414979; ENSG00000073060. [Q8WTV0-1]
GeneID949.
KEGGhsa:949.
UCSCuc001ugm.4. human. [Q8WTV0-2]
uc001ugo.4. human. [Q8WTV0-1]
uc031qke.1. human. [Q8WTV0-4]

Organism-specific databases

CTD949.
GeneCardsGC12M125262.
HGNCHGNC:1664. SCARB1.
MIM601040. gene.
610762. phenotype.
neXtProtNX_Q8WTV0.
PharmGKBPA97.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG257244.
HOVERGENHBG106577.
InParanoidQ8WTV0.
KOK13885.
OMADNDTVSF.
OrthoDBEOG79SDWX.
PhylomeDBQ8WTV0.
TreeFamTF317925.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
REACT_160300. Binding and Uptake of Ligands by Scavenger Receptors.

Gene expression databases

ArrayExpressQ8WTV0.
BgeeQ8WTV0.
CleanExHS_SCARB1.
GenevestigatorQ8WTV0.

Family and domain databases

InterProIPR002159. CD36.
IPR005428. CD36_antigen.
[Graphical view]
PANTHERPTHR11923. PTHR11923. 1 hit.
PfamPF01130. CD36. 1 hit.
[Graphical view]
PRINTSPR01610. CD36ANTIGEN.
PR01609. CD36FAMILY.
ProtoNetSearch...

Other

ChiTaRSSCARB1. human.
GeneWikiSCARB1.
GenomeRNAi949.
NextBio3946.
PROQ8WTV0.
SOURCESearch...

Entry information

Entry nameSCRB1_HUMAN
AccessionPrimary (citable) accession number: Q8WTV0
Secondary accession number(s): F8W8N0 expand/collapse secondary AC list , Q14016, Q52LZ5, Q6KFX4
Entry history
Integrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: March 1, 2002
Last modified: July 9, 2014
This is version 126 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM