Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8WTV0

- SCRB1_HUMAN

UniProt

Q8WTV0 - SCRB1_HUMAN

Protein

Scavenger receptor class B member 1

Gene

SCARB1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 128 (01 Oct 2014)
      Sequence version 1 (01 Mar 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity. Receptor for hepatitis C virus glycoprotein E2. Binding between SCARB1 and E2 was found to be independent of the genotype of the viral isolate. Plays an important role in the uptake of HDL cholesteryl ester By similarity.By similarity

    GO - Molecular functioni

    1. 1-phosphatidylinositol binding Source: BHF-UCL
    2. apolipoprotein A-I binding Source: BHF-UCL
    3. apolipoprotein binding Source: BHF-UCL
    4. high-density lipoprotein particle binding Source: Ensembl
    5. high-density lipoprotein particle receptor activity Source: BHF-UCL
    6. lipopolysaccharide binding Source: BHF-UCL
    7. lipopolysaccharide receptor activity Source: BHF-UCL
    8. low-density lipoprotein particle binding Source: BHF-UCL
    9. phosphatidylserine binding Source: BHF-UCL
    10. protein binding Source: IntAct
    11. transporter activity Source: ProtInc

    GO - Biological processi

    1. adhesion of symbiont to host Source: BHF-UCL
    2. androgen biosynthetic process Source: Ensembl
    3. blood vessel endothelial cell migration Source: Ensembl
    4. cell adhesion Source: InterPro
    5. cholesterol catabolic process Source: Ensembl
    6. cholesterol efflux Source: BHF-UCL
    7. cholesterol homeostasis Source: BHF-UCL
    8. cholesterol import Source: BHF-UCL
    9. detection of lipopolysaccharide Source: BHF-UCL
    10. endothelial cell proliferation Source: Ensembl
    11. high-density lipoprotein particle clearance Source: BHF-UCL
    12. high-density lipoprotein particle remodeling Source: BHF-UCL
    13. lipopolysaccharide-mediated signaling pathway Source: GOC
    14. lipopolysaccharide transport Source: BHF-UCL
    15. lipoprotein metabolic process Source: Reactome
    16. low-density lipoprotein particle clearance Source: BHF-UCL
    17. phospholipid transport Source: BHF-UCL
    18. positive regulation of cholesterol storage Source: BHF-UCL
    19. positive regulation of endothelial cell migration Source: BHF-UCL
    20. positive regulation of nitric-oxide synthase activity Source: BHF-UCL
    21. positive regulation of triglyceride biosynthetic process Source: BHF-UCL
    22. receptor-mediated endocytosis Source: GOC
    23. recognition of apoptotic cell Source: BHF-UCL
    24. regulation of phagocytosis Source: BHF-UCL
    25. regulation of phosphatidylcholine catabolic process Source: BHF-UCL
    26. reverse cholesterol transport Source: BHF-UCL
    27. small molecule metabolic process Source: Reactome
    28. triglyceride homeostasis Source: BHF-UCL
    29. viral process Source: UniProtKB-KW
    30. wound healing Source: BHF-UCL

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Host-virus interaction

    Enzyme and pathway databases

    ReactomeiREACT_13621. HDL-mediated lipid transport.
    REACT_163679. Scavenging by Class B Receptors.

    Protein family/group databases

    TCDBi9.B.39.1.3. the long chain fatty acid translocase (lcfat) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Scavenger receptor class B member 1
    Short name:
    SRB1
    Alternative name(s):
    CD36 and LIMPII analogous 1
    Short name:
    CLA-1
    CD36 antigen-like 1
    Collagen type I receptor, thrombospondin receptor-like 1
    SR-BI
    CD_antigen: CD36
    Gene namesi
    Name:SCARB1
    Synonyms:CD36L1, CLA1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:1664. SCARB1.

    Subcellular locationi

    Cell membrane; Multi-pass membrane protein. Membranecaveola; Multi-pass membrane protein
    Note: Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae.

    GO - Cellular componenti

    1. caveola Source: BHF-UCL
    2. cell surface Source: Ensembl
    3. endocytic vesicle membrane Source: Reactome
    4. extracellular vesicular exosome Source: UniProt
    5. integral component of plasma membrane Source: Ensembl
    6. lysosomal membrane Source: UniProtKB
    7. microvillus membrane Source: Ensembl
    8. plasma membrane Source: BHF-UCL

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    MIMi610762. phenotype.
    PharmGKBiPA97.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 552552Scavenger receptor class B member 1PRO_0000144160Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi102 – 1021N-linked (GlcNAc...)2 Publications
    Glycosylationi108 – 1081N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi173 – 1731N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi212 – 2121N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi227 – 2271N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi251 ↔ 384By similarity
    Glycosylationi255 – 2551N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi310 – 3101N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi330 – 3301N-linked (GlcNAc...)2 Publications
    Glycosylationi383 – 3831N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    N-glycosylated.2 Publications
    The six cysteines of the extracellular domain are all involved in intramolecular disulfide bonds.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ8WTV0.
    PaxDbiQ8WTV0.
    PRIDEiQ8WTV0.

    PTM databases

    PhosphoSiteiQ8WTV0.

    Expressioni

    Tissue specificityi

    Widely expressed.

    Gene expression databases

    ArrayExpressiQ8WTV0.
    BgeeiQ8WTV0.
    CleanExiHS_SCARB1.
    GenevestigatoriQ8WTV0.

    Interactioni

    Subunit structurei

    Plays a critical role in HCV attachment and/or cell entry by interacting with HCV E1/E2 glycoproteins heterodimer. The C-terminal region binds to PDZK1 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    P279582EBI-78657,EBI-6904269From a different organism.

    Protein-protein interaction databases

    BioGridi107387. 7 interactions.
    IntActiQ8WTV0. 6 interactions.
    MINTiMINT-5001419.
    STRINGi9606.ENSP00000261693.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8WTV0.
    SMRiQ8WTV0. Positions 51-434.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1111CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini33 – 443411ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini465 – 55288CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei12 – 3221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei444 – 46421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the CD36 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG257244.
    HOVERGENiHBG106577.
    InParanoidiQ8WTV0.
    KOiK13885.
    OMAiDNDTVSF.
    OrthoDBiEOG79SDWX.
    PhylomeDBiQ8WTV0.
    TreeFamiTF317925.

    Family and domain databases

    InterProiIPR002159. CD36.
    IPR005428. CD36_antigen.
    [Graphical view]
    PANTHERiPTHR11923. PTHR11923. 1 hit.
    PfamiPF01130. CD36. 1 hit.
    [Graphical view]
    PRINTSiPR01610. CD36ANTIGEN.
    PR01609. CD36FAMILY.

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 3 (identifier: Q8WTV0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGCSAKARWA AGALGVAGLL CAVLGAVMIV MVPSLIKQQV LKNVRIDPSS    50
    LSFNMWKEIP IPFYLSVYFF DVMNPSEILK GEKPQVRERG PYVYREFRHK 100
    SNITFNNNDT VSFLEYRTFQ FQPSKSHGSE SDYIVMPNIL VLGAAVMMEN 150
    KPMTLKLIMT LAFTTLGERA FMNRTVGEIM WGYKDPLVNL INKYFPGMFP 200
    FKDKFGLFAE LNNSDSGLFT VFTGVQNISR IHLVDKWNGL SKVDFWHSDQ 250
    CNMINGTSGQ MWPPFMTPES SLEFYSPEAC RSMKLMYKES GVFEGIPTYR 300
    FVAPKTLFAN GSIYPPNEGF CPCLESGIQN VSTCRFSAPL FLSHPHFLNA 350
    DPVLAEAVTG LHPNQEAHSL FLDIHPVTGI PMNCSVKLQL SLYMKSVAGI 400
    GQTGKIEPVV LPLLWFAESG AMEGETLHTF YTQLVLMPKV MHYAQYVLLA 450
    LGCVLLLVPV ICQIRSQVGA GQRAARADSH SLACWGKGAS DRTLWPTAAW 500
    SPPPAAVLRL CRSGSGHCWG LRSTLASFAC RVATTLPVLE GLGPSLGGGT 550
    GS 552

    Note: May be due to a competing donor splice site. No experimental confirmation available.

    Length:552
    Mass (Da):60,878
    Last modified:March 1, 2002 - v1
    Checksum:i06B0BD771FEA284F
    GO
    Isoform 1 (identifier: Q8WTV0-2) [UniParc]FASTAAdd to Basket

    Also known as: SR-BI

    The sequence of this isoform differs from the canonical sequence as follows:
         468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

    Show »
    Length:509
    Mass (Da):56,973
    Checksum:i0184AE9CEC595374
    GO
    Isoform 2 (identifier: Q8WTV0-3) [UniParc]FASTAAdd to Basket

    Also known as: SR-BII

    The sequence of this isoform differs from the canonical sequence as follows:
         43-142: Missing.
         468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

    Show »
    Length:409
    Mass (Da):45,103
    Checksum:i88B30340CD403541
    GO
    Isoform 4 (identifier: Q8WTV0-4) [UniParc]FASTAAdd to Basket

    Also known as: SR-BIII

    The sequence of this isoform differs from the canonical sequence as follows:
         1-42: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLK → MALQPSW
         468-552: VGAGQRAARA...GPSLGGGTGS → EKCYLFWSSS...KGSVLQEAKL

    Show »
    Length:474
    Mass (Da):53,579
    Checksum:i1CF55DEB32EF3D3B
    GO
    Isoform 5 (identifier: Q8WTV0-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         468-552: VGAGQRAARA...GPSLGGGTGS → GPEDTVSQPG...PSGQPPSPTA

    Note: No experimental confirmation available. Gene prediction based on EST data.

    Show »
    Length:506
    Mass (Da):56,170
    Checksum:i73C1ED23924F2B49
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti70 – 701F → L in AAQ08185. 1 PublicationCurated
    Sequence conflicti97 – 971F → S in CAA80277. (PubMed:7689561)Curated

    Polymorphismi

    Genetic variations in SCARB1 define the high density lipoprotein cholesterol level quantitative trait locus 6 (HDLCQ16) [MIMi:610762].

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti2 – 21G → S Associated with higher plasma triglyceride concentration in subjects with hypercholesterolemia. 2 Publications
    Corresponds to variant rs4238001 [ dbSNP | Ensembl ].
    VAR_017098
    Natural varianti135 – 1351V → I.1 Publication
    Corresponds to variant rs5891 [ dbSNP | Ensembl ].
    VAR_017099
    Natural varianti167 – 1671G → S.1 Publication
    Corresponds to variant rs199588922 [ dbSNP | Ensembl ].
    VAR_017100
    Natural varianti229 – 2291S → G.
    Corresponds to variant rs10396213 [ dbSNP | Ensembl ].
    VAR_019507
    Natural varianti297 – 2971P → S Mutation carriers have increased HDL cholesterol levels and a reduction in cholesterol efflux from macrophages. 1 Publication
    VAR_064909
    Natural varianti511 – 5111C → R.
    Corresponds to variant rs2293440 [ dbSNP | Ensembl ].
    VAR_017101

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4242MGCSA…QQVLK → MALQPSW in isoform 4. 1 PublicationVSP_011037Add
    BLAST
    Alternative sequencei43 – 142100Missing in isoform 2. 1 PublicationVSP_008553Add
    BLAST
    Alternative sequencei468 – 55285VGAGQ…GGTGS → EKCYLFWSSSKKGSKDKEAI QAYSESLMTSAPKGSVLQEA KL in isoform 1, isoform 2 and isoform 4. 3 PublicationsVSP_008554Add
    BLAST
    Alternative sequencei468 – 55285VGAGQ…GGTGS → GPEDTVSQPGLAAGPDRPPS PYTPLLPDSPSGQPPSPTA in isoform 5. CuratedVSP_054083Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z22555 mRNA. Translation: CAA80277.1.
    AF515445 mRNA. Translation: AAQ08185.1.
    AC073593 Genomic DNA. No translation available.
    AC126309 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW98459.1.
    BC022087 mRNA. No translation available.
    BC080647 mRNA. Translation: AAH80647.1.
    BC093732 mRNA. Translation: AAH93732.1.
    BC112037 mRNA. Translation: AAI12038.1.
    CCDSiCCDS45008.1. [Q8WTV0-5]
    CCDS9259.1. [Q8WTV0-2]
    PIRiS36656. A48528.
    RefSeqiNP_001076428.1. NM_001082959.1. [Q8WTV0-5]
    NP_005496.4. NM_005505.4. [Q8WTV0-2]
    UniGeneiHs.731377.

    Genome annotation databases

    EnsembliENST00000261693; ENSP00000261693; ENSG00000073060. [Q8WTV0-2]
    ENST00000339570; ENSP00000343795; ENSG00000073060. [Q8WTV0-5]
    ENST00000415380; ENSP00000414979; ENSG00000073060. [Q8WTV0-1]
    GeneIDi949.
    KEGGihsa:949.
    UCSCiuc001ugm.4. human. [Q8WTV0-2]
    uc001ugo.4. human. [Q8WTV0-1]
    uc031qke.1. human. [Q8WTV0-4]

    Polymorphism databases

    DMDMi37999904.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z22555 mRNA. Translation: CAA80277.1 .
    AF515445 mRNA. Translation: AAQ08185.1 .
    AC073593 Genomic DNA. No translation available.
    AC126309 Genomic DNA. No translation available.
    CH471054 Genomic DNA. Translation: EAW98459.1 .
    BC022087 mRNA. No translation available.
    BC080647 mRNA. Translation: AAH80647.1 .
    BC093732 mRNA. Translation: AAH93732.1 .
    BC112037 mRNA. Translation: AAI12038.1 .
    CCDSi CCDS45008.1. [Q8WTV0-5 ]
    CCDS9259.1. [Q8WTV0-2 ]
    PIRi S36656. A48528.
    RefSeqi NP_001076428.1. NM_001082959.1. [Q8WTV0-5 ]
    NP_005496.4. NM_005505.4. [Q8WTV0-2 ]
    UniGenei Hs.731377.

    3D structure databases

    ProteinModelPortali Q8WTV0.
    SMRi Q8WTV0. Positions 51-434.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107387. 7 interactions.
    IntActi Q8WTV0. 6 interactions.
    MINTi MINT-5001419.
    STRINGi 9606.ENSP00000261693.

    Chemistry

    BindingDBi Q8WTV0.
    ChEMBLi CHEMBL1914272.
    DrugBanki DB00144. Phosphatidylserine.

    Protein family/group databases

    TCDBi 9.B.39.1.3. the long chain fatty acid translocase (lcfat) family.

    PTM databases

    PhosphoSitei Q8WTV0.

    Polymorphism databases

    DMDMi 37999904.

    Proteomic databases

    MaxQBi Q8WTV0.
    PaxDbi Q8WTV0.
    PRIDEi Q8WTV0.

    Protocols and materials databases

    DNASUi 949.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261693 ; ENSP00000261693 ; ENSG00000073060 . [Q8WTV0-2 ]
    ENST00000339570 ; ENSP00000343795 ; ENSG00000073060 . [Q8WTV0-5 ]
    ENST00000415380 ; ENSP00000414979 ; ENSG00000073060 . [Q8WTV0-1 ]
    GeneIDi 949.
    KEGGi hsa:949.
    UCSCi uc001ugm.4. human. [Q8WTV0-2 ]
    uc001ugo.4. human. [Q8WTV0-1 ]
    uc031qke.1. human. [Q8WTV0-4 ]

    Organism-specific databases

    CTDi 949.
    GeneCardsi GC12M125262.
    HGNCi HGNC:1664. SCARB1.
    MIMi 601040. gene.
    610762. phenotype.
    neXtProti NX_Q8WTV0.
    PharmGKBi PA97.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG257244.
    HOVERGENi HBG106577.
    InParanoidi Q8WTV0.
    KOi K13885.
    OMAi DNDTVSF.
    OrthoDBi EOG79SDWX.
    PhylomeDBi Q8WTV0.
    TreeFami TF317925.

    Enzyme and pathway databases

    Reactomei REACT_13621. HDL-mediated lipid transport.
    REACT_163679. Scavenging by Class B Receptors.

    Miscellaneous databases

    ChiTaRSi SCARB1. human.
    GeneWikii SCARB1.
    GenomeRNAii 949.
    NextBioi 3946.
    PROi Q8WTV0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8WTV0.
    Bgeei Q8WTV0.
    CleanExi HS_SCARB1.
    Genevestigatori Q8WTV0.

    Family and domain databases

    InterProi IPR002159. CD36.
    IPR005428. CD36_antigen.
    [Graphical view ]
    PANTHERi PTHR11923. PTHR11923. 1 hit.
    Pfami PF01130. CD36. 1 hit.
    [Graphical view ]
    PRINTSi PR01610. CD36ANTIGEN.
    PR01609. CD36FAMILY.
    ProtoNeti Search...

    Publicationsi

    1. "Identification, primary structure and distribution of CLA-1, a novel member of the CD36/LIMPII gene family."
      Calvo D., Vega M.
      J. Biol. Chem. 268:18929-18935(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Promyelocyte.
    2. Hirano K., Yamashita S., Matsuzawa Y.
      Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Liver, Prostate and Rhabdomyosarcoma.
    6. "The human scavenger receptor class B type I is a novel candidate receptor for the hepatitis C virus."
      Scarselli E., Ansuini H., Cerino R., Roccasecca R.M., Acali S., Filocamo G., Traboni C., Nicosia A., Cortese R., Vitelli A.
      EMBO J. 21:5017-5025(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    7. "Phosphatidylserine binding of class B scavenger receptor type I, a phagocytosis receptor of testicular Sertoli cells."
      Kawasaki Y., Nakagawa A., Nagaosa K., Shiratsuchi A., Nakanishi Y.
      J. Biol. Chem. 277:27559-27566(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION.
    8. "Cell entry of hepatitis C virus requires a set of co-receptors that include the CD81 tetraspanin and the SR-B1 scavenger receptor."
      Bartosch B., Vitelli A., Granier C., Goujon C., Dubuisson J., Pascale S., Scarselli E., Cortese R., Nicosia A., Cosset F.-L.
      J. Biol. Chem. 278:41624-41630(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH HCV E1/E2 ENVELOPE HETERODIMER.
    9. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-102 AND ASN-330.
      Tissue: Liver.
    10. "Biological, clinical and population relevance of 95 loci for blood lipids."
      Teslovich T.M., Musunuru K., Smith A.V., Edmondson A.C., Stylianou I.M., Koseki M., Pirruccello J.P., Ripatti S., Chasman D.I., Willer C.J., Johansen C.T., Fouchier S.W., Isaacs A., Peloso G.M., Barbalic M., Ricketts S.L., Bis J.C., Aulchenko Y.S.
      , Thorleifsson G., Feitosa M.F., Chambers J., Orho-Melander M., Melander O., Johnson T., Li X., Guo X., Li M., Shin Cho Y., Jin Go M., Jin Kim Y., Lee J.Y., Park T., Kim K., Sim X., Twee-Hee Ong R., Croteau-Chonka D.C., Lange L.A., Smith J.D., Song K., Hua Zhao J., Yuan X., Luan J., Lamina C., Ziegler A., Zhang W., Zee R.Y., Wright A.F., Witteman J.C., Wilson J.F., Willemsen G., Wichmann H.E., Whitfield J.B., Waterworth D.M., Wareham N.J., Waeber G., Vollenweider P., Voight B.F., Vitart V., Uitterlinden A.G., Uda M., Tuomilehto J., Thompson J.R., Tanaka T., Surakka I., Stringham H.M., Spector T.D., Soranzo N., Smit J.H., Sinisalo J., Silander K., Sijbrands E.J., Scuteri A., Scott J., Schlessinger D., Sanna S., Salomaa V., Saharinen J., Sabatti C., Ruokonen A., Rudan I., Rose L.M., Roberts R., Rieder M., Psaty B.M., Pramstaller P.P., Pichler I., Perola M., Penninx B.W., Pedersen N.L., Pattaro C., Parker A.N., Pare G., Oostra B.A., O'Donnell C.J., Nieminen M.S., Nickerson D.A., Montgomery G.W., Meitinger T., McPherson R., McCarthy M.I., McArdle W., Masson D., Martin N.G., Marroni F., Mangino M., Magnusson P.K., Lucas G., Luben R., Loos R.J., Lokki M.L., Lettre G., Langenberg C., Launer L.J., Lakatta E.G., Laaksonen R., Kyvik K.O., Kronenberg F., Konig I.R., Khaw K.T., Kaprio J., Kaplan L.M., Johansson A., Jarvelin M.R., Janssens A.C., Ingelsson E., Igl W., Kees Hovingh G., Hottenga J.J., Hofman A., Hicks A.A., Hengstenberg C., Heid I.M., Hayward C., Havulinna A.S., Hastie N.D., Harris T.B., Haritunians T., Hall A.S., Gyllensten U., Guiducci C., Groop L.C., Gonzalez E., Gieger C., Freimer N.B., Ferrucci L., Erdmann J., Elliott P., Ejebe K.G., Doring A., Dominiczak A.F., Demissie S., Deloukas P., de Geus E.J., de Faire U., Crawford G., Collins F.S., Chen Y.D., Caulfield M.J., Campbell H., Burtt N.P., Bonnycastle L.L., Boomsma D.I., Boekholdt S.M., Bergman R.N., Barroso I., Bandinelli S., Ballantyne C.M., Assimes T.L., Quertermous T., Altshuler D., Seielstad M., Wong T.Y., Tai E.S., Feranil A.B., Kuzawa C.W., Adair L.S., Taylor H.A. Jr., Borecki I.B., Gabriel S.B., Wilson J.G., Holm H., Thorsteinsdottir U., Gudnason V., Krauss R.M., Mohlke K.L., Ordovas J.M., Munroe P.B., Kooner J.S., Tall A.R., Hegele R.A., Kastelein J.J., Schadt E.E., Rotter J.I., Boerwinkle E., Strachan D.P., Mooser V., Stefansson K., Reilly M.P., Samani N.J., Schunkert H., Cupples L.A., Sandhu M.S., Ridker P.M., Rader D.J., van Duijn C.M., Peltonen L., Abecasis G.R., Boehnke M., Kathiresan S.
      Nature 466:707-713(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN HDLCQ16.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "Polymorphisms at the SRBI locus are associated with lipoprotein levels in subjects with heterozygous familial hypercholesterolemia."
      Tai E.S., Adiconis X., Ordovas J.M., Carmena-Ramon R., Real J., Corella D., Ascaso J., Carmena R.
      Clin. Genet. 63:53-58(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT SER-2.
    13. "Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors."
      Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C.
      Hum. Mol. Genet. 12:2733-2743(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS SER-2; ILE-135 AND SER-167.
    14. Cited for: VARIANT SER-297, INVOLVEMENT IN HDLCQ16.

    Entry informationi

    Entry nameiSCRB1_HUMAN
    AccessioniPrimary (citable) accession number: Q8WTV0
    Secondary accession number(s): F8W8N0
    , Q14016, Q52LZ5, Q6KFX4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 10, 2003
    Last sequence update: March 1, 2002
    Last modified: October 1, 2014
    This is version 128 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3