Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfhydryl oxidase 1

Gene

QSOX1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Sulfhydryl oxidase involved in the regulation of cation homeostasis. Positively regulates shoot accumulation of K+ and inhibits accumulation of toxic cations. Acts at the level of root K+ efflux systems involved in xylem loading (root symplast-xylem interface).1 Publication

Catalytic activityi

2 R'C(R)SH + O2 = R'C(R)S-S(R)CR' + H2O2.

Cofactori

FADPROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei72NucleophileBy similarity1
Active sitei75NucleophileBy similarity1
Binding sitei300FADBy similarity1
Binding sitei307FADBy similarity1
Binding sitei311FADBy similarity1
Binding sitei341FADBy similarity1
Binding sitei345FADBy similarity1
Binding sitei394FADBy similarity1
Binding sitei397FADBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi368 – 375FADBy similarity8

GO - Molecular functioni

GO - Biological processi

  • cell redox homeostasis Source: InterPro
  • positive regulation of potassium ion transport Source: UniProtKB
  • protein folding Source: GO_Central
  • response to cation stress Source: TAIR
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

FAD, Flavoprotein

Enzyme and pathway databases

BioCyciARA:AT1G15020-MONOMER.
BRENDAi1.8.3.2. 399.
ReactomeiR-ATH-114608. Platelet degranulation.
R-ATH-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfhydryl oxidase 1 (EC:1.8.3.2)
Alternative name(s):
Quiescin-sulfhydryl oxidase 1
Short name:
AtQSOX1
Gene namesi
Name:QSOX1
Synonyms:QSO2
Ordered Locus Names:At1g15020
ORF Names:T15D22.7
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 1

Organism-specific databases

TAIRiAT1G15020.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell wall, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000040005020 – 528Sulfhydryl oxidase 1Add BLAST509

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi72 ↔ 75Redox-activePROSITE-ProRule annotation
Glycosylationi186N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi292 ↔ 304PROSITE-ProRule annotation
Glycosylationi297N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi339 ↔ 342PROSITE-ProRule annotation
Disulfide bondi403 ↔ 406PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8W4J3.
PRIDEiQ8W4J3.

Expressioni

Tissue specificityi

Highly expressed in roots.1 Publication

Inductioni

By salt and norspermidine treatments and phosphate starvation.1 Publication

Gene expression databases

GenevisibleiQ8W4J3. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT1G15020.2.

Structurei

3D structure databases

ProteinModelPortaliQ8W4J3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 170ThioredoxinPROSITE-ProRule annotationAdd BLAST136
Domaini295 – 397ERV/ALR sulfhydryl oxidasePROSITE-ProRule annotationAdd BLAST103

Sequence similaritiesi

Contains 1 ERV/ALR sulfhydryl oxidase domain.PROSITE-ProRule annotation
Contains 1 thioredoxin domain.PROSITE-ProRule annotation

Keywords - Domaini

Redox-active center, Signal

Phylogenomic databases

eggNOGiKOG1731. Eukaryota.
ENOG410XVJT. LUCA.
HOGENOMiHOG000029909.
InParanoidiQ8W4J3.
KOiK10758.
OMAiLRNFHIC.
OrthoDBiEOG093607HV.
PhylomeDBiQ8W4J3.

Family and domain databases

Gene3Di1.20.120.310. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR017905. ERV/ALR_sulphydryl_oxidase.
IPR012336. Thioredoxin-like_fold.
IPR017937. Thioredoxin_CS.
IPR013766. Thioredoxin_domain.
[Graphical view]
PfamiPF04777. Evr1_Alr. 1 hit.
PF00085. Thioredoxin. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.
SSF69000. SSF69000. 1 hit.
PROSITEiPS51324. ERV_ALR. 1 hit.
PS00194. THIOREDOXIN_1. 1 hit.
PS51352. THIOREDOXIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8W4J3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLIHLFLLL GLLSLEAAAS FSPGSRSILR DIGSNVADQK DNAIELNATN
60 70 80 90 100
FDSVFQDSPA KYAVLEFFAH WCPACRNYKP HYEKVARLFN GADAVYPGVV
110 120 130 140 150
LMTRVDCAIK MNVKLCDKFS INHYPMLFWA PPKRFVGGSW GPKQEKNEIS
160 170 180 190 200
VVNEWRTADL LLNWINKQIG SSYGLDDQKL GNLLSNISDQ EQISQAIFDI
210 220 230 240 250
EEATEEAFDI ILAHKAIKSS ETSASFIRFL QLLVAHHPSR RCRTGSAEIL
260 270 280 290 300
VNFDDICPSG ECSYDQESGA KDSLRNFHIC GKDVPRGYYR FCRGSKNETR
310 320 330 340 350
GFSCGLWVLM HSLSVRIEDG ESQFAFTAIC DFINNFFMCD DCRRHFHDMC
360 370 380 390 400
LSVKTPFKKA RDIALWLWST HNKVNERLKK DEDSLGTGDP KFPKMIWPPK
410 420 430 440 450
QLCPSCYLSS TEKNIDWDHD QVYKFLKKYY GQKLVSVYKK NGESVSKEEV
460 470 480 490 500
IAAAEEMAVP TNALVVPVGA ALAIALASCA FGALACYWRT QQKNRKYNYN
510 520
PHYLKRYNSN YMVMNTFSNT ESEREKER
Length:528
Mass (Da):60,087
Last modified:March 1, 2002 - v1
Checksum:i99D1E9B46492F976
GO
Isoform 2 (identifier: Q8W4J3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     497-527: YNYNPHYLKRYNSNYMVMNTFSNTESEREKE → QQIQR

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:502
Mass (Da):56,835
Checksum:i468377F27AD580D1
GO

Sequence cautioni

The sequence AAF31025 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_039985497 – 527YNYNP…EREKE → QQIQR in isoform 2. CuratedAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC012189 Genomic DNA. Translation: AAF31025.1. Sequence problems.
CP002684 Genomic DNA. Translation: AEE29255.1.
CP002684 Genomic DNA. Translation: AEE29256.1.
AY062528 mRNA. Translation: AAL32606.1.
BT001218 mRNA. Translation: AAN65105.1.
PIRiG86283.
RefSeqiNP_172955.1. NM_101371.5. [Q8W4J3-1]
NP_849664.1. NM_179333.2. [Q8W4J3-2]
UniGeneiAt.27408.

Genome annotation databases

EnsemblPlantsiAT1G15020.2; AT1G15020.2; AT1G15020. [Q8W4J3-1]
GeneIDi838067.
GrameneiAT1G15020.2; AT1G15020.2; AT1G15020.
KEGGiath:AT1G15020.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC012189 Genomic DNA. Translation: AAF31025.1. Sequence problems.
CP002684 Genomic DNA. Translation: AEE29255.1.
CP002684 Genomic DNA. Translation: AEE29256.1.
AY062528 mRNA. Translation: AAL32606.1.
BT001218 mRNA. Translation: AAN65105.1.
PIRiG86283.
RefSeqiNP_172955.1. NM_101371.5. [Q8W4J3-1]
NP_849664.1. NM_179333.2. [Q8W4J3-2]
UniGeneiAt.27408.

3D structure databases

ProteinModelPortaliQ8W4J3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT1G15020.2.

Proteomic databases

PaxDbiQ8W4J3.
PRIDEiQ8W4J3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT1G15020.2; AT1G15020.2; AT1G15020. [Q8W4J3-1]
GeneIDi838067.
GrameneiAT1G15020.2; AT1G15020.2; AT1G15020.
KEGGiath:AT1G15020.

Organism-specific databases

TAIRiAT1G15020.

Phylogenomic databases

eggNOGiKOG1731. Eukaryota.
ENOG410XVJT. LUCA.
HOGENOMiHOG000029909.
InParanoidiQ8W4J3.
KOiK10758.
OMAiLRNFHIC.
OrthoDBiEOG093607HV.
PhylomeDBiQ8W4J3.

Enzyme and pathway databases

BioCyciARA:AT1G15020-MONOMER.
BRENDAi1.8.3.2. 399.
ReactomeiR-ATH-114608. Platelet degranulation.
R-ATH-6798695. Neutrophil degranulation.

Miscellaneous databases

PROiQ8W4J3.

Gene expression databases

GenevisibleiQ8W4J3. AT.

Family and domain databases

Gene3Di1.20.120.310. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR017905. ERV/ALR_sulphydryl_oxidase.
IPR012336. Thioredoxin-like_fold.
IPR017937. Thioredoxin_CS.
IPR013766. Thioredoxin_domain.
[Graphical view]
PfamiPF04777. Evr1_Alr. 1 hit.
PF00085. Thioredoxin. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.
SSF69000. SSF69000. 1 hit.
PROSITEiPS51324. ERV_ALR. 1 hit.
PS00194. THIOREDOXIN_1. 1 hit.
PS51352. THIOREDOXIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiQSOX1_ARATH
AccessioniPrimary (citable) accession number: Q8W4J3
Secondary accession number(s): Q3EDC3, Q9M9Q3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 2, 2010
Last sequence update: March 1, 2002
Last modified: November 30, 2016
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Miscellaneous

Plants lacking QSOX1 display more sensitivity to the toxic cations lithium and sodium than wild-type plants.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.