Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8W4J3 (QSOX1_ARATH) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 92. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sulfhydryl oxidase 1

EC=1.8.3.2
Alternative name(s):
Quiescin-sulfhydryl oxidase 1
Short name=AtQSOX1
Gene names
Name:QSOX1
Synonyms:QSO2
Ordered Locus Names:At1g15020
ORF Names:T15D22.7
OrganismArabidopsis thaliana (Mouse-ear cress) [Reference proteome]
Taxonomic identifier3702 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis

Protein attributes

Sequence length528 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Sulfhydryl oxidase involved in the regulation of cation homeostasis. Positively regulates shoot accumulation of K+ and inhibits accumulation of toxic cations. Acts at the level of root K+ efflux systems involved in xylem loading (root symplast-xylem interface). Ref.4

Catalytic activity

2 R'C(R)SH + O2 = R'C(R)S-S(R)CR' + H2O2.

Cofactor

FAD By similarity.

Subcellular location

Secretedcell wall. Note: Associated with the cell wall. Ref.4

Tissue specificity

Highly expressed in roots. Ref.4

Induction

By salt and norspermidine treatments and phosphate starvation. Ref.4

Miscellaneous

Plants lacking QSOX1 display more sensitivity to the toxic cations lithium and sodium than wild-type plants.

Sequence similarities

Contains 1 ERV/ALR sulfhydryl oxidase domain.

Contains 1 thioredoxin domain.

Sequence caution

The sequence AAF31025.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8W4J3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8W4J3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     497-527: YNYNPHYLKRYNSNYMVMNTFSNTESEREKE → QQIQR
Note: Derived from EST data. No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1919 Potential
Chain20 – 528509Sulfhydryl oxidase 1
PRO_0000400050

Regions

Domain35 – 170136Thioredoxin
Domain295 – 397103ERV/ALR sulfhydryl oxidase
Nucleotide binding368 – 3758FAD By similarity

Sites

Active site721Nucleophile By similarity
Active site751Nucleophile By similarity
Binding site3001FAD By similarity
Binding site3071FAD By similarity
Binding site3111FAD By similarity
Binding site3411FAD By similarity
Binding site3451FAD By similarity
Binding site3941FAD By similarity
Binding site3971FAD By similarity

Amino acid modifications

Glycosylation471N-linked (GlcNAc...) Potential
Glycosylation1861N-linked (GlcNAc...) Potential
Glycosylation2971N-linked (GlcNAc...) Potential
Disulfide bond72 ↔ 75Redox-active By similarity
Disulfide bond292 ↔ 304 By similarity
Disulfide bond339 ↔ 342 By similarity
Disulfide bond403 ↔ 406 By similarity

Natural variations

Alternative sequence497 – 52731YNYNP…EREKE → QQIQR in isoform 2.
VSP_039985

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2002. Version 1.
Checksum: 99D1E9B46492F976

FASTA52860,087
        10         20         30         40         50         60 
MSLIHLFLLL GLLSLEAAAS FSPGSRSILR DIGSNVADQK DNAIELNATN FDSVFQDSPA 

        70         80         90        100        110        120 
KYAVLEFFAH WCPACRNYKP HYEKVARLFN GADAVYPGVV LMTRVDCAIK MNVKLCDKFS 

       130        140        150        160        170        180 
INHYPMLFWA PPKRFVGGSW GPKQEKNEIS VVNEWRTADL LLNWINKQIG SSYGLDDQKL 

       190        200        210        220        230        240 
GNLLSNISDQ EQISQAIFDI EEATEEAFDI ILAHKAIKSS ETSASFIRFL QLLVAHHPSR 

       250        260        270        280        290        300 
RCRTGSAEIL VNFDDICPSG ECSYDQESGA KDSLRNFHIC GKDVPRGYYR FCRGSKNETR 

       310        320        330        340        350        360 
GFSCGLWVLM HSLSVRIEDG ESQFAFTAIC DFINNFFMCD DCRRHFHDMC LSVKTPFKKA 

       370        380        390        400        410        420 
RDIALWLWST HNKVNERLKK DEDSLGTGDP KFPKMIWPPK QLCPSCYLSS TEKNIDWDHD 

       430        440        450        460        470        480 
QVYKFLKKYY GQKLVSVYKK NGESVSKEEV IAAAEEMAVP TNALVVPVGA ALAIALASCA 

       490        500        510        520 
FGALACYWRT QQKNRKYNYN PHYLKRYNSN YMVMNTFSNT ESEREKER 

« Hide

Isoform 2 [UniParc].

Checksum: 468377F27AD580D1
Show »

FASTA50256,835

References

« Hide 'large scale' references
[1]"Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K. expand/collapse author list , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Columbia.
[2]The Arabidopsis Information Resource (TAIR)
Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
Cited for: GENOME REANNOTATION.
Strain: cv. Columbia.
[3]"Empirical analysis of transcriptional activity in the Arabidopsis genome."
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. expand/collapse author list , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: cv. Columbia.
[4]"An Arabidopsis quiescin-sulfhydryl oxidase regulates cation homeostasis at the root symplast-xylem interface."
Alejandro S., Rodriguez P.L., Belles J.M., Yenush L., Garcia-Sanchez M.J., Fernandez J.A., Serrano R.
EMBO J. 26:3203-3215(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC012189 Genomic DNA. Translation: AAF31025.1. Sequence problems.
CP002684 Genomic DNA. Translation: AEE29255.1.
CP002684 Genomic DNA. Translation: AEE29256.1.
AY062528 mRNA. Translation: AAL32606.1.
BT001218 mRNA. Translation: AAN65105.1.
PIRG86283.
RefSeqNP_172955.1. NM_101371.4. [Q8W4J3-1]
NP_849664.1. NM_179333.1. [Q8W4J3-2]
UniGeneAt.27408.

3D structure databases

ProteinModelPortalQ8W4J3.
SMRQ8W4J3. Positions 35-430.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING3702.AT1G15020.2-P.

Proteomic databases

PaxDbQ8W4J3.
PRIDEQ8W4J3.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsAT1G15020.2; AT1G15020.2; AT1G15020. [Q8W4J3-1]
GeneID838067.
KEGGath:AT1G15020.

Organism-specific databases

TAIRAT1G15020.

Phylogenomic databases

eggNOGNOG237986.
HOGENOMHOG000029909.
InParanoidQ8W4J3.
OMAIILMTRV.
PhylomeDBQ8W4J3.

Enzyme and pathway databases

BioCycARA:AT1G15020-MONOMER.
ARA:GQT-1737-MONOMER.

Gene expression databases

GenevestigatorQ8W4J3.

Family and domain databases

Gene3D1.20.120.310. 1 hit.
3.40.30.10. 1 hit.
InterProIPR017905. ERV/ALR_sulphydryl_oxidase.
IPR012336. Thioredoxin-like_fold.
IPR017937. Thioredoxin_CS.
IPR013766. Thioredoxin_domain.
IPR001841. Znf_RING.
[Graphical view]
PfamPF04777. Evr1_Alr. 1 hit.
PF00085. Thioredoxin. 1 hit.
[Graphical view]
SMARTSM00184. RING. 1 hit.
[Graphical view]
SUPFAMSSF52833. SSF52833. 1 hit.
SSF69000. SSF69000. 1 hit.
PROSITEPS51324. ERV_ALR. 1 hit.
PS00194. THIOREDOXIN_1. 1 hit.
PS51352. THIOREDOXIN_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameQSOX1_ARATH
AccessionPrimary (citable) accession number: Q8W4J3
Secondary accession number(s): Q3EDC3, Q9M9Q3
Entry history
Integrated into UniProtKB/Swiss-Prot: November 2, 2010
Last sequence update: March 1, 2002
Last modified: June 11, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Arabidopsis thaliana

Arabidopsis thaliana: entries and gene names