Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8W4J3

- QSOX1_ARATH

UniProt

Q8W4J3 - QSOX1_ARATH

Protein

Sulfhydryl oxidase 1

Gene

QSOX1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 1 (01 Mar 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Sulfhydryl oxidase involved in the regulation of cation homeostasis. Positively regulates shoot accumulation of K+ and inhibits accumulation of toxic cations. Acts at the level of root K+ efflux systems involved in xylem loading (root symplast-xylem interface).1 Publication

    Catalytic activityi

    2 R'C(R)SH + O2 = R'C(R)S-S(R)CR' + H2O2.

    Cofactori

    FAD.PROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei72 – 721NucleophileBy similarity
    Active sitei75 – 751NucleophileBy similarity
    Binding sitei300 – 3001FADBy similarity
    Binding sitei307 – 3071FADBy similarity
    Binding sitei311 – 3111FADBy similarity
    Binding sitei341 – 3411FADBy similarity
    Binding sitei345 – 3451FADBy similarity
    Binding sitei394 – 3941FADBy similarity
    Binding sitei397 – 3971FADBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi368 – 3758FADBy similarity

    GO - Molecular functioni

    1. thiol oxidase activity Source: UniProtKB
    2. zinc ion binding Source: InterPro

    GO - Biological processi

    1. cell redox homeostasis Source: InterPro
    2. positive regulation of potassium ion transport Source: UniProtKB
    3. response to cation stress Source: TAIR

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Ligandi

    FAD, Flavoprotein

    Enzyme and pathway databases

    BioCyciARA:AT1G15020-MONOMER.
    ARA:GQT-1737-MONOMER.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sulfhydryl oxidase 1 (EC:1.8.3.2)
    Alternative name(s):
    Quiescin-sulfhydryl oxidase 1
    Short name:
    AtQSOX1
    Gene namesi
    Name:QSOX1
    Synonyms:QSO2
    Ordered Locus Names:At1g15020
    ORF Names:T15D22.7
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 1

    Organism-specific databases

    TAIRiAT1G15020.

    Subcellular locationi

    Secretedcell wall 1 Publication
    Note: Associated with the cell wall.

    GO - Cellular componenti

    1. cell wall Source: UniProtKB-SubCell
    2. extracellular region Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell wall, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1919Sequence AnalysisAdd
    BLAST
    Chaini20 – 528509Sulfhydryl oxidase 1PRO_0000400050Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi47 – 471N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi72 ↔ 75Redox-activePROSITE-ProRule annotation
    Glycosylationi186 – 1861N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi292 ↔ 304PROSITE-ProRule annotation
    Glycosylationi297 – 2971N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi339 ↔ 342PROSITE-ProRule annotation
    Disulfide bondi403 ↔ 406PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ8W4J3.
    PRIDEiQ8W4J3.

    Expressioni

    Tissue specificityi

    Highly expressed in roots.1 Publication

    Inductioni

    By salt and norspermidine treatments and phosphate starvation.1 Publication

    Gene expression databases

    GenevestigatoriQ8W4J3.

    Interactioni

    Protein-protein interaction databases

    STRINGi3702.AT1G15020.2-P.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8W4J3.
    SMRiQ8W4J3. Positions 35-430.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini35 – 170136ThioredoxinPROSITE-ProRule annotationAdd
    BLAST
    Domaini295 – 397103ERV/ALR sulfhydryl oxidasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 ERV/ALR sulfhydryl oxidase domain.PROSITE-ProRule annotation
    Contains 1 thioredoxin domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Redox-active center, Signal

    Phylogenomic databases

    eggNOGiNOG237986.
    HOGENOMiHOG000029909.
    InParanoidiQ8W4J3.
    OMAiIILMTRV.
    PhylomeDBiQ8W4J3.

    Family and domain databases

    Gene3Di1.20.120.310. 1 hit.
    3.40.30.10. 1 hit.
    InterProiIPR017905. ERV/ALR_sulphydryl_oxidase.
    IPR012336. Thioredoxin-like_fold.
    IPR017937. Thioredoxin_CS.
    IPR013766. Thioredoxin_domain.
    IPR001841. Znf_RING.
    [Graphical view]
    PfamiPF04777. Evr1_Alr. 1 hit.
    PF00085. Thioredoxin. 1 hit.
    [Graphical view]
    SMARTiSM00184. RING. 1 hit.
    [Graphical view]
    SUPFAMiSSF52833. SSF52833. 1 hit.
    SSF69000. SSF69000. 1 hit.
    PROSITEiPS51324. ERV_ALR. 1 hit.
    PS00194. THIOREDOXIN_1. 1 hit.
    PS51352. THIOREDOXIN_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8W4J3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSLIHLFLLL GLLSLEAAAS FSPGSRSILR DIGSNVADQK DNAIELNATN    50
    FDSVFQDSPA KYAVLEFFAH WCPACRNYKP HYEKVARLFN GADAVYPGVV 100
    LMTRVDCAIK MNVKLCDKFS INHYPMLFWA PPKRFVGGSW GPKQEKNEIS 150
    VVNEWRTADL LLNWINKQIG SSYGLDDQKL GNLLSNISDQ EQISQAIFDI 200
    EEATEEAFDI ILAHKAIKSS ETSASFIRFL QLLVAHHPSR RCRTGSAEIL 250
    VNFDDICPSG ECSYDQESGA KDSLRNFHIC GKDVPRGYYR FCRGSKNETR 300
    GFSCGLWVLM HSLSVRIEDG ESQFAFTAIC DFINNFFMCD DCRRHFHDMC 350
    LSVKTPFKKA RDIALWLWST HNKVNERLKK DEDSLGTGDP KFPKMIWPPK 400
    QLCPSCYLSS TEKNIDWDHD QVYKFLKKYY GQKLVSVYKK NGESVSKEEV 450
    IAAAEEMAVP TNALVVPVGA ALAIALASCA FGALACYWRT QQKNRKYNYN 500
    PHYLKRYNSN YMVMNTFSNT ESEREKER 528
    Length:528
    Mass (Da):60,087
    Last modified:March 1, 2002 - v1
    Checksum:i99D1E9B46492F976
    GO
    Isoform 2 (identifier: Q8W4J3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         497-527: YNYNPHYLKRYNSNYMVMNTFSNTESEREKE → QQIQR

    Note: Derived from EST data. No experimental confirmation available.

    Show »
    Length:502
    Mass (Da):56,835
    Checksum:i468377F27AD580D1
    GO

    Sequence cautioni

    The sequence AAF31025.1 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei497 – 52731YNYNP…EREKE → QQIQR in isoform 2. CuratedVSP_039985Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC012189 Genomic DNA. Translation: AAF31025.1. Sequence problems.
    CP002684 Genomic DNA. Translation: AEE29255.1.
    CP002684 Genomic DNA. Translation: AEE29256.1.
    AY062528 mRNA. Translation: AAL32606.1.
    BT001218 mRNA. Translation: AAN65105.1.
    PIRiG86283.
    RefSeqiNP_172955.1. NM_101371.4. [Q8W4J3-1]
    NP_849664.1. NM_179333.1. [Q8W4J3-2]
    UniGeneiAt.27408.

    Genome annotation databases

    EnsemblPlantsiAT1G15020.2; AT1G15020.2; AT1G15020. [Q8W4J3-1]
    GeneIDi838067.
    KEGGiath:AT1G15020.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC012189 Genomic DNA. Translation: AAF31025.1 . Sequence problems.
    CP002684 Genomic DNA. Translation: AEE29255.1 .
    CP002684 Genomic DNA. Translation: AEE29256.1 .
    AY062528 mRNA. Translation: AAL32606.1 .
    BT001218 mRNA. Translation: AAN65105.1 .
    PIRi G86283.
    RefSeqi NP_172955.1. NM_101371.4. [Q8W4J3-1 ]
    NP_849664.1. NM_179333.1. [Q8W4J3-2 ]
    UniGenei At.27408.

    3D structure databases

    ProteinModelPortali Q8W4J3.
    SMRi Q8W4J3. Positions 35-430.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 3702.AT1G15020.2-P.

    Proteomic databases

    PaxDbi Q8W4J3.
    PRIDEi Q8W4J3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT1G15020.2 ; AT1G15020.2 ; AT1G15020 . [Q8W4J3-1 ]
    GeneIDi 838067.
    KEGGi ath:AT1G15020.

    Organism-specific databases

    TAIRi AT1G15020.

    Phylogenomic databases

    eggNOGi NOG237986.
    HOGENOMi HOG000029909.
    InParanoidi Q8W4J3.
    OMAi IILMTRV.
    PhylomeDBi Q8W4J3.

    Enzyme and pathway databases

    BioCyci ARA:AT1G15020-MONOMER.
    ARA:GQT-1737-MONOMER.

    Gene expression databases

    Genevestigatori Q8W4J3.

    Family and domain databases

    Gene3Di 1.20.120.310. 1 hit.
    3.40.30.10. 1 hit.
    InterProi IPR017905. ERV/ALR_sulphydryl_oxidase.
    IPR012336. Thioredoxin-like_fold.
    IPR017937. Thioredoxin_CS.
    IPR013766. Thioredoxin_domain.
    IPR001841. Znf_RING.
    [Graphical view ]
    Pfami PF04777. Evr1_Alr. 1 hit.
    PF00085. Thioredoxin. 1 hit.
    [Graphical view ]
    SMARTi SM00184. RING. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52833. SSF52833. 1 hit.
    SSF69000. SSF69000. 1 hit.
    PROSITEi PS51324. ERV_ALR. 1 hit.
    PS00194. THIOREDOXIN_1. 1 hit.
    PS51352. THIOREDOXIN_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
      Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K.
      , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
      Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    2. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
      Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
      , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
      Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: cv. Columbia.
    4. "An Arabidopsis quiescin-sulfhydryl oxidase regulates cation homeostasis at the root symplast-xylem interface."
      Alejandro S., Rodriguez P.L., Belles J.M., Yenush L., Garcia-Sanchez M.J., Fernandez J.A., Serrano R.
      EMBO J. 26:3203-3215(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.

    Entry informationi

    Entry nameiQSOX1_ARATH
    AccessioniPrimary (citable) accession number: Q8W4J3
    Secondary accession number(s): Q3EDC3, Q9M9Q3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 2, 2010
    Last sequence update: March 1, 2002
    Last modified: October 1, 2014
    This is version 93 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Miscellaneous

    Plants lacking QSOX1 display more sensitivity to the toxic cations lithium and sodium than wild-type plants.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3