SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8W4J3

- QSOX1_ARATH

UniProt

Q8W4J3 - QSOX1_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Sulfhydryl oxidase 1
Gene
QSOX1, QSO2, At1g15020, T15D22.7
Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Sulfhydryl oxidase involved in the regulation of cation homeostasis. Positively regulates shoot accumulation of K+ and inhibits accumulation of toxic cations. Acts at the level of root K+ efflux systems involved in xylem loading (root symplast-xylem interface).1 Publication

Catalytic activityi

2 R'C(R)SH + O2 = R'C(R)S-S(R)CR' + H2O2.

Cofactori

FAD By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei72 – 721Nucleophile By similarity
Active sitei75 – 751Nucleophile By similarity
Binding sitei300 – 3001FAD By similarity
Binding sitei307 – 3071FAD By similarity
Binding sitei311 – 3111FAD By similarity
Binding sitei341 – 3411FAD By similarity
Binding sitei345 – 3451FAD By similarity
Binding sitei394 – 3941FAD By similarity
Binding sitei397 – 3971FAD By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi368 – 3758FAD By similarity

GO - Molecular functioni

  1. thiol oxidase activity Source: UniProtKB
  2. zinc ion binding Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. cell redox homeostasis Source: InterPro
  2. positive regulation of potassium ion transport Source: UniProtKB
  3. response to cation stress Source: TAIR
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

FAD, Flavoprotein

Enzyme and pathway databases

BioCyciARA:AT1G15020-MONOMER.
ARA:GQT-1737-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfhydryl oxidase 1 (EC:1.8.3.2)
Alternative name(s):
Quiescin-sulfhydryl oxidase 1
Short name:
AtQSOX1
Gene namesi
Name:QSOX1
Synonyms:QSO2
Ordered Locus Names:At1g15020
ORF Names:T15D22.7
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 1

Organism-specific databases

TAIRiAT1G15020.

Subcellular locationi

Secretedcell wall
Note: Associated with the cell wall.1 Publication

GO - Cellular componenti

  1. cell wall Source: UniProtKB-SubCell
  2. extracellular region Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell wall, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1919 Reviewed prediction
Add
BLAST
Chaini20 – 528509Sulfhydryl oxidase 1
PRO_0000400050Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi47 – 471N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi72 ↔ 75Redox-active By similarity
Glycosylationi186 – 1861N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi292 ↔ 304 By similarity
Glycosylationi297 – 2971N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi339 ↔ 342 By similarity
Disulfide bondi403 ↔ 406 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8W4J3.
PRIDEiQ8W4J3.

Expressioni

Tissue specificityi

Highly expressed in roots.1 Publication

Inductioni

By salt and norspermidine treatments and phosphate starvation.1 Publication

Gene expression databases

GenevestigatoriQ8W4J3.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT1G15020.2-P.

Structurei

3D structure databases

ProteinModelPortaliQ8W4J3.
SMRiQ8W4J3. Positions 35-430.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 170136Thioredoxin
Add
BLAST
Domaini295 – 397103ERV/ALR sulfhydryl oxidase
Add
BLAST

Sequence similaritiesi

Contains 1 thioredoxin domain.

Keywords - Domaini

Redox-active center, Signal

Phylogenomic databases

eggNOGiNOG237986.
HOGENOMiHOG000029909.
InParanoidiQ8W4J3.
OMAiIILMTRV.
PhylomeDBiQ8W4J3.

Family and domain databases

Gene3Di1.20.120.310. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR017905. ERV/ALR_sulphydryl_oxidase.
IPR012336. Thioredoxin-like_fold.
IPR017937. Thioredoxin_CS.
IPR013766. Thioredoxin_domain.
IPR001841. Znf_RING.
[Graphical view]
PfamiPF04777. Evr1_Alr. 1 hit.
PF00085. Thioredoxin. 1 hit.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.
SSF69000. SSF69000. 1 hit.
PROSITEiPS51324. ERV_ALR. 1 hit.
PS00194. THIOREDOXIN_1. 1 hit.
PS51352. THIOREDOXIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8W4J3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSLIHLFLLL GLLSLEAAAS FSPGSRSILR DIGSNVADQK DNAIELNATN    50
FDSVFQDSPA KYAVLEFFAH WCPACRNYKP HYEKVARLFN GADAVYPGVV 100
LMTRVDCAIK MNVKLCDKFS INHYPMLFWA PPKRFVGGSW GPKQEKNEIS 150
VVNEWRTADL LLNWINKQIG SSYGLDDQKL GNLLSNISDQ EQISQAIFDI 200
EEATEEAFDI ILAHKAIKSS ETSASFIRFL QLLVAHHPSR RCRTGSAEIL 250
VNFDDICPSG ECSYDQESGA KDSLRNFHIC GKDVPRGYYR FCRGSKNETR 300
GFSCGLWVLM HSLSVRIEDG ESQFAFTAIC DFINNFFMCD DCRRHFHDMC 350
LSVKTPFKKA RDIALWLWST HNKVNERLKK DEDSLGTGDP KFPKMIWPPK 400
QLCPSCYLSS TEKNIDWDHD QVYKFLKKYY GQKLVSVYKK NGESVSKEEV 450
IAAAEEMAVP TNALVVPVGA ALAIALASCA FGALACYWRT QQKNRKYNYN 500
PHYLKRYNSN YMVMNTFSNT ESEREKER 528
Length:528
Mass (Da):60,087
Last modified:March 1, 2002 - v1
Checksum:i99D1E9B46492F976
GO
Isoform 2 (identifier: Q8W4J3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     497-527: YNYNPHYLKRYNSNYMVMNTFSNTESEREKE → QQIQR

Note: Derived from EST data. No experimental confirmation available.

Show »
Length:502
Mass (Da):56,835
Checksum:i468377F27AD580D1
GO

Sequence cautioni

The sequence AAF31025.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei497 – 52731YNYNP…EREKE → QQIQR in isoform 2.
VSP_039985Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC012189 Genomic DNA. Translation: AAF31025.1. Sequence problems.
CP002684 Genomic DNA. Translation: AEE29255.1.
CP002684 Genomic DNA. Translation: AEE29256.1.
AY062528 mRNA. Translation: AAL32606.1.
BT001218 mRNA. Translation: AAN65105.1.
PIRiG86283.
RefSeqiNP_172955.1. NM_101371.4. [Q8W4J3-1]
NP_849664.1. NM_179333.1. [Q8W4J3-2]
UniGeneiAt.27408.

Genome annotation databases

EnsemblPlantsiAT1G15020.2; AT1G15020.2; AT1G15020. [Q8W4J3-1]
GeneIDi838067.
KEGGiath:AT1G15020.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC012189 Genomic DNA. Translation: AAF31025.1 . Sequence problems.
CP002684 Genomic DNA. Translation: AEE29255.1 .
CP002684 Genomic DNA. Translation: AEE29256.1 .
AY062528 mRNA. Translation: AAL32606.1 .
BT001218 mRNA. Translation: AAN65105.1 .
PIRi G86283.
RefSeqi NP_172955.1. NM_101371.4. [Q8W4J3-1 ]
NP_849664.1. NM_179333.1. [Q8W4J3-2 ]
UniGenei At.27408.

3D structure databases

ProteinModelPortali Q8W4J3.
SMRi Q8W4J3. Positions 35-430.
ModBasei Search...

Protein-protein interaction databases

STRINGi 3702.AT1G15020.2-P.

Proteomic databases

PaxDbi Q8W4J3.
PRIDEi Q8W4J3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT1G15020.2 ; AT1G15020.2 ; AT1G15020 . [Q8W4J3-1 ]
GeneIDi 838067.
KEGGi ath:AT1G15020.

Organism-specific databases

TAIRi AT1G15020.

Phylogenomic databases

eggNOGi NOG237986.
HOGENOMi HOG000029909.
InParanoidi Q8W4J3.
OMAi IILMTRV.
PhylomeDBi Q8W4J3.

Enzyme and pathway databases

BioCyci ARA:AT1G15020-MONOMER.
ARA:GQT-1737-MONOMER.

Gene expression databases

Genevestigatori Q8W4J3.

Family and domain databases

Gene3Di 1.20.120.310. 1 hit.
3.40.30.10. 1 hit.
InterProi IPR017905. ERV/ALR_sulphydryl_oxidase.
IPR012336. Thioredoxin-like_fold.
IPR017937. Thioredoxin_CS.
IPR013766. Thioredoxin_domain.
IPR001841. Znf_RING.
[Graphical view ]
Pfami PF04777. Evr1_Alr. 1 hit.
PF00085. Thioredoxin. 1 hit.
[Graphical view ]
SMARTi SM00184. RING. 1 hit.
[Graphical view ]
SUPFAMi SSF52833. SSF52833. 1 hit.
SSF69000. SSF69000. 1 hit.
PROSITEi PS51324. ERV_ALR. 1 hit.
PS00194. THIOREDOXIN_1. 1 hit.
PS51352. THIOREDOXIN_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
    Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K.
    , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
    Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: cv. Columbia.
  4. "An Arabidopsis quiescin-sulfhydryl oxidase regulates cation homeostasis at the root symplast-xylem interface."
    Alejandro S., Rodriguez P.L., Belles J.M., Yenush L., Garcia-Sanchez M.J., Fernandez J.A., Serrano R.
    EMBO J. 26:3203-3215(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.

Entry informationi

Entry nameiQSOX1_ARATH
AccessioniPrimary (citable) accession number: Q8W4J3
Secondary accession number(s): Q3EDC3, Q9M9Q3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 2, 2010
Last sequence update: March 1, 2002
Last modified: June 11, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Miscellaneous

Plants lacking QSOX1 display more sensitivity to the toxic cations lithium and sodium than wild-type plants.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi