Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable protein S-acyltransferase 9

Gene

PAT09

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Palmitoyl acyltransferase.By similarity1 Publication

Catalytic activityi

Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei166S-palmitoyl cysteine intermediateBy similarity1

GO - Molecular functioni

Keywordsi

Molecular functionAcyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.3.1.225. 399.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable protein S-acyltransferase 9 (EC:2.3.1.225)
Alternative name(s):
Probable palmitoyltransferase At5g50020
Zinc finger DHHC domain-containing protein At5g50020
Gene namesi
Name:PAT09
Ordered Locus Names:At5g50020
ORF Names:MPF21.3
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

TAIRilocus:2170046. AT5G50020.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei28 – 48HelicalSequence analysisAdd BLAST21
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Transmembranei174 – 194HelicalSequence analysisAdd BLAST21
Transmembranei217 – 237HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003153521 – 407Probable protein S-acyltransferase 9Add BLAST407

Keywords - PTMi

Lipoprotein, Palmitate

Proteomic databases

PaxDbiQ8VYS8.
PRIDEiQ8VYS8.

PTM databases

iPTMnetiQ8VYS8.

Expressioni

Tissue specificityi

Mainly expressed in seeds.1 Publication

Gene expression databases

GenevisibleiQ8VYS8. AT.

Interactioni

Protein-protein interaction databases

BioGridi20312. 2 interactors.
IntActiQ8VYS8. 2 interactors.
STRINGi3702.AT5G50020.2.

Structurei

3D structure databases

SMRiQ8VYS8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini136 – 179DHHCPROSITE-ProRule annotationAdd BLAST44

Domaini

The DHHC domain is required for palmitoyltransferase activity.By similarity

Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1311. Eukaryota.
COG5273. LUCA.
HOGENOMiHOG000242943.
InParanoidiQ8VYS8.
OMAiGIDIEMG.
PhylomeDBiQ8VYS8.

Family and domain databases

InterProiView protein in InterPro
IPR001594. Palmitoyltrfase_DHHC.
PfamiView protein in Pfam
PF01529. zf-DHHC. 1 hit.
PROSITEiView protein in PROSITE
PS50216. DHHC. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VYS8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGRVFEAWK GSNKFLFGGR LIFGPDAWSI PFTFLLIITP VCFFSVFVAT
60 70 80 90 100
HLRRELLPNN AGHVFLVAGV LFTVFVLILL FLTSARDPGI VPRNSHPPEE
110 120 130 140 150
ELCYDTTVSS DGRQTPTVQI PRTKEVMVYG VSVRVKYCDT CMLYRPPRCS
160 170 180 190 200
HCSICNNCVE RFDHHCPWRN YRYFFMFVSS ATILCIYIFS MSALYIKVLM
210 220 230 240 250
DNHQGTVWRA MRESPWAVML MIYCFISLWF VGGLTGFHLY LISTNQTTYE
260 270 280 290 300
NFRYRSDNRI NVYNRGCSNN FFETFCSKVK PSRNDFRAFI KEEPPRNITL
310 320 330 340 350
ATTWERPEEA DEENREERRQ KVEDDLDIDE DVMKLQQRLN DEEGSDTAHH
360 370 380 390 400
KIDIDQMRIG SNERAPTIRS EARHGNWGAR SNAQEEDVIA GSSVRESRSY

AAAEEGR
Length:407
Mass (Da):47,105
Last modified:March 1, 2002 - v1
Checksum:iD404CBF9F4B5CBB7
GO
Isoform 2 (identifier: Q8VYS8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNDSWSAGPDRILQFVRECSEECLIRSLILM
     168-168: W → WVGQCIGV

Note: No experimental confirmation available. Derived from EST data.
Show »
Length:444
Mass (Da):51,225
Checksum:iF008E67E13DD35E9
GO
Isoform 3 (identifier: Q8VYS8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-168: W → WVGQCIGV

Note: No experimental confirmation available.
Show »
Length:414
Mass (Da):47,761
Checksum:i8AE90D8E1B6A9D28
GO

Sequence cautioni

The sequence BAB10288 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0474381M → MNDSWSAGPDRILQFVRECS EECLIRSLILM in isoform 2. Curated1
Alternative sequenceiVSP_047439168W → WVGQCIGV in isoform 2 and isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
JF792493 mRNA. Translation: AEF58502.1.
AB026650 Genomic DNA. Translation: BAB10288.1. Sequence problems.
CP002688 Genomic DNA. Translation: AED95886.1.
CP002688 Genomic DNA. Translation: AED95887.1.
CP002688 Genomic DNA. Translation: ANM68839.1.
AY070050 mRNA. Translation: AAL49807.1.
AY096683 mRNA. Translation: AAM20317.1.
RefSeqiNP_001190503.1. NM_001203574.1. [Q8VYS8-2]
NP_001330558.1. NM_001344870.1. [Q8VYS8-3]
NP_199813.2. NM_124381.3. [Q8VYS8-1]
UniGeneiAt.28420.

Genome annotation databases

EnsemblPlantsiAT5G50020.1; AT5G50020.1; AT5G50020. [Q8VYS8-1]
GeneIDi835066.
GrameneiAT5G50020.1; AT5G50020.1; AT5G50020.
KEGGiath:AT5G50020.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
JF792493 mRNA. Translation: AEF58502.1.
AB026650 Genomic DNA. Translation: BAB10288.1. Sequence problems.
CP002688 Genomic DNA. Translation: AED95886.1.
CP002688 Genomic DNA. Translation: AED95887.1.
CP002688 Genomic DNA. Translation: ANM68839.1.
AY070050 mRNA. Translation: AAL49807.1.
AY096683 mRNA. Translation: AAM20317.1.
RefSeqiNP_001190503.1. NM_001203574.1. [Q8VYS8-2]
NP_001330558.1. NM_001344870.1. [Q8VYS8-3]
NP_199813.2. NM_124381.3. [Q8VYS8-1]
UniGeneiAt.28420.

3D structure databases

SMRiQ8VYS8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi20312. 2 interactors.
IntActiQ8VYS8. 2 interactors.
STRINGi3702.AT5G50020.2.

PTM databases

iPTMnetiQ8VYS8.

Proteomic databases

PaxDbiQ8VYS8.
PRIDEiQ8VYS8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT5G50020.1; AT5G50020.1; AT5G50020. [Q8VYS8-1]
GeneIDi835066.
GrameneiAT5G50020.1; AT5G50020.1; AT5G50020.
KEGGiath:AT5G50020.

Organism-specific databases

AraportiAT5G50020.
TAIRilocus:2170046. AT5G50020.

Phylogenomic databases

eggNOGiKOG1311. Eukaryota.
COG5273. LUCA.
HOGENOMiHOG000242943.
InParanoidiQ8VYS8.
OMAiGIDIEMG.
PhylomeDBiQ8VYS8.

Enzyme and pathway databases

BRENDAi2.3.1.225. 399.

Miscellaneous databases

PROiPR:Q8VYS8.

Gene expression databases

GenevisibleiQ8VYS8. AT.

Family and domain databases

InterProiView protein in InterPro
IPR001594. Palmitoyltrfase_DHHC.
PfamiView protein in Pfam
PF01529. zf-DHHC. 1 hit.
PROSITEiView protein in PROSITE
PS50216. DHHC. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiZDH24_ARATH
AccessioniPrimary (citable) accession number: Q8VYS8
Secondary accession number(s): F4K7H9, F6MDM7, Q9FGA9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: March 1, 2002
Last modified: April 12, 2017
This is version 91 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.