Q8VWZ8 (SMO22_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 69.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Methylsterol monooxygenase 2-2 EC=1.14.13.72 Alternative name(s): Sterol 4-alpha-methyl-oxidase 1 Short name=AtSMO1 Sterol 4-alpha-methyl-oxidase 2-2 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 266 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Non-heme iron oxygenase involved in sterols biosynthesis. 24-ethylidenelophenol and 24-ethyllophenol are the preferred substrates. Ref.1 |
| Catalytic activity | 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O2 = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha-cholest-7-en-3-beta-ol + CA NAD(P)+ + H2O. 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O2 = 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)+ + 2 H2O. 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest-7-ene-4-alpha-arbaldehyde + NAD(P)H + O2 = 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)+ + H2O. |
| Cofactor | Iron By similarity. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Miscellaneous | Requires a membrane-bound cytochrome b5 as an obligatory electron carrier from NAD(P)H to SMO. |
| Sequence similarities | Belongs to the sterol desaturase family. |
| Sequence caution | The sequence AAF79571.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8VWZ8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8VWZ8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-55: MASFVESGWQYLVTHFSDFQLACIGSFLLHESVFFLSGLPFIFLERQGFLSKYKI → MLLLPFMVNTYFSFVPM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 266 | 266 | Methylsterol monooxygenase 2-2 | PRO_0000413165 | |||||
Regions | |||||||||
| Transmembrane | 24 – 44 | 21 | Helical; Potential | ||||||
| Transmembrane | 71 – 91 | 21 | Helical; Potential | ||||||
| Transmembrane | 107 – 127 | 21 | Helical; Potential | ||||||
| Transmembrane | 162 – 182 | 21 | Helical; Potential | ||||||
| Motif | 127 – 131 | 5 | Histidine box-1 | ||||||
| Motif | 140 – 144 | 5 | Histidine box-2 | ||||||
| Motif | 219 – 225 | 7 | Histidine box-3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 55 | 55 | MASFV…SKYKI → MLLLPFMVNTYFSFVPM in isoform 2. | VSP_041865 | |||||
Experimental info | |||||||||
| Sequence conflict | 29 | 1 | L → F in AAM64821. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Functional identification of sterol-4alpha-methyl oxidase cDNAs from Arabidopsis thaliana by complementation of a yeast erg25 mutant lacking sterol-4alpha-methyl oxidation." Darnet S., Bard M., Rahier A. FEBS Lett. 508:39-43(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. Strain: cv. Columbia. Tissue: Silique. |
| [2] | "Plant sterol biosynthesis: identification of two distinct families of sterol 4alpha-methyl oxidases." Darnet S., Rahier A. Biochem. J. 378:889-898(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GENE FAMILY, NOMENCLATURE. Strain: cv. Columbia. Tissue: Silique. |
| [3] | "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana." Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K. Davis R.W.Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [4] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [5] | "Full-length cDNA from Arabidopsis thaliana." Brover V.V., Troukhan M.E., Alexandrov N.A., Lu Y.-P., Flavell R.B., Feldmann K.A. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Arabidopsis ORF clones." de los Reyes C., Quan R., Chen H., Bautista V., Kim C.J., Ecker J.R. Submitted (OCT-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "Analysis of multiple occurrences of alternative splicing events in Arabidopsis thaliana using novel sequenced full-length cDNAs." Iida K., Fukami-Kobayashi K., Toyoda A., Sakaki Y., Kobayashi M., Seki M., Shinozaki K. DNA Res. 16:155-164(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: cv. Columbia. Tissue: Rosette leaf. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF346734 mRNA. Translation: AAL32303.1. AC022464 Genomic DNA. Translation: AAF79571.1. Sequence problems. CP002684 Genomic DNA. Translation: AEE28122.1. CP002684 Genomic DNA. Translation: AEE28123.1. AY087267 mRNA. Translation: AAM64821.1. BT044610 mRNA. Translation: ACI31310.1. AK316820 mRNA. Translation: BAH19532.1. |
| IPI | IPI00528164. |
| RefSeq | NP_563789.1. NM_100616.2. NP_973777.1. NM_202048.2. |
| UniGene | At.27344. At.67216. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 3702.AT1G07420.1-P. |
Protocols and materials databases | |
| DNASU | 837254. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT1G07420.1; AT1G07420.1; AT1G07420. |
| GeneID | 837254. |
| KEGG | ath:AT1G07420. |
Organism-specific databases | |
| TAIR | At1g07420. |
Phylogenomic databases | |
| eggNOG | COG3000. |
| HOGENOM | HOG000162289. |
| InParanoid | Q8VWZ8. |
| KO | K14424. |
| OMA | KNNTPAA. |
| PhylomeDB | Q8VWZ8. |
| ProtClustDB | CLSN2916981. |
Enzyme and pathway databases | |
| BioCyc | ARA:AT1G07420-MONOMER. MetaCyc:AT1G07420-MONOMER. |
| BRENDA | 1.14.13.72. 302. |
Gene expression databases | |
| ArrayExpress | Q8VWZ8. |
| Genevestigator | Q8VWZ8. |
Family and domain databases | |
| InterPro | IPR006694. Fatty_acid_hydroxylase. [Graphical view] |
| Pfam | PF04116. FA_hydroxylase. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | SMO22_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q8VWZ8 Secondary accession number(s): B9DFL5, Q8LBE1, Q9LNW2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with
