Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone H1oo

Gene

H1foo

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

May play a key role in the control of gene expression during oogenesis and early embryogenesis, presumably through the perturbation of chromatin structure. Essential for meiotic maturation of germinal vesicle-stage oocytes. The somatic type linker histone H1c is rapidly replaced by H1oo in a donor nucleus transplanted into an oocyte. The greater mobility of H1oo as compared to H1c may contribute to this rapid replacement and increased instability of the embryonic chromatin structure. The rapid replacement of H1c with H1oo may play an important role in nuclear remodeling.4 Publications

GO - Molecular functioni

  • DNA binding Source: MGI
  • nucleosomal DNA binding Source: UniProtKB

GO - Biological processi

  • meiotic cell cycle Source: UniProtKB-KW
  • negative regulation of stem cell differentiation Source: UniProtKB
  • nucleosome assembly Source: MGI
  • nucleosome positioning Source: UniProtKB
  • regulation of DNA methylation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Meiosis

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Histone H1oo
Alternative name(s):
Oocyte-specific histone H1
Oocyte-specific linker histone H1
Gene namesi
Name:H1foo
Synonyms:H1oo
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2176207. H1foo.

Subcellular locationi

  • Cytoplasm By similarity
  • Nucleus
  • Chromosome

  • Note: In the germinal vesicle oocyte, localizes to the condensed chromosomes. In the 1-cell embryo found in condensed maternal metaphase chromatin but not in the sperm head. Following second polar body extrusion, detected in the swollen sperm head as well as in the second polar body. Reduced expression in the nucleus in 2-cell embryo is seen as compared to 1-cell embryo.

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • extracellular exosome Source: MGI
  • female germ cell nucleus Source: MGI
  • nucleosome Source: InterPro
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 304304Histone H1ooPRO_0000343413Add
BLAST

Proteomic databases

PaxDbiQ8VIK3.
PRIDEiQ8VIK3.

PTM databases

iPTMnetiQ8VIK3.
PhosphoSiteiQ8VIK3.

Expressioni

Tissue specificityi

Oocyte-specific.2 Publications

Developmental stagei

Expressed as early as the germinal vesicle (GV) stage oocyte, and persists into the metaphase II stage oocyte, the oocytic polar bodies, and the 2-cell embryo, and disappears at the 4-to 8-cell embryonic stage.1 Publication

Gene expression databases

BgeeiENSMUSG00000042279.
ExpressionAtlasiQ8VIK3. baseline and differential.
GenevisibleiQ8VIK3. MM.

Interactioni

GO - Molecular functioni

  • nucleosomal DNA binding Source: UniProtKB

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000036951.

Structurei

3D structure databases

ProteinModelPortaliQ8VIK3.
SMRiQ8VIK3. Positions 42-126.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 12379H15PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi154 – 17017Nuclear localization signalSequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi5 – 139Poly-Ser

Sequence similaritiesi

Belongs to the histone H1/H5 family.PROSITE-ProRule annotation
Contains 1 H15 (linker histone H1/H5 globular) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4012. Eukaryota.
ENOG4112541. LUCA.
GeneTreeiENSGT00720000108877.
HOGENOMiHOG000112841.
HOVERGENiHBG096668.
InParanoidiQ8VIK3.
OMAiMNTDEVE.
OrthoDBiEOG091G0LIU.
PhylomeDBiQ8VIK3.
TreeFamiTF333386.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR005818. Histone_H1/H5_H15.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00538. Linker_histone. 1 hit.
[Graphical view]
SMARTiSM00526. H15. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
PROSITEiPS51504. H15. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VIK3-1) [UniParc]FASTAAdd to basket
Also known as: Alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPGSVSSVS SSSFPSRDTS PSGSCGLPGA DKPGPSCRRI QAGQRNPTML
60 70 80 90 100
HMVLEALKAR EARQGTSVVA IKVYIQHKYP TVDTTRFKYL LKQALETGVR
110 120 130 140 150
RGLLTRPAHS KAKGATGSFK LVPKPKTKKA CAPKAGRGAA GAKETGSKKS
160 170 180 190 200
GLLKKDQVGK ATMEKGQKRR AYPCKAATLE MAPKKAKAKP KEVRKAPLKQ
210 220 230 240 250
DKAAGAPLTA NGGQKVKRSG SRQEANAHGK TKGEKSKPLA SKVQNSVASL
260 270 280 290 300
AKRKMADMAH TVTVVQGAET VQETKVPTPS QDIGHKVQPI PRVRKAKTPE

NTQA
Length:304
Mass (Da):32,223
Last modified:March 1, 2002 - v1
Checksum:i716400ADF8CA8FE4
GO
Isoform 2 (identifier: Q8VIK3-2) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     244-304: QNSVASLAKRKMADMAHTVTVVQGAETVQETKVPTPSQDIGHKVQPIPRVRKAKTPENTQA → GPE

Show »
Length:246
Mass (Da):25,919
Checksum:iA76B3DC10CAAC502
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei244 – 30461QNSVA…ENTQA → GPE in isoform 2. 1 PublicationVSP_034593Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY007195 mRNA. Translation: AAG01890.1.
AK135944 mRNA. Translation: BAE22736.1.
AK162137 mRNA. Translation: BAE36747.1.
CH466523 Genomic DNA. Translation: EDK99547.1.
BC137916 mRNA. Translation: AAI37917.1.
CCDSiCCDS20447.1. [Q8VIK3-1]
RefSeqiNP_612184.1. NM_138311.3. [Q8VIK3-1]
XP_006505741.1. XM_006505678.2. [Q8VIK3-2]
UniGeneiMm.21899.

Genome annotation databases

EnsembliENSMUST00000037831; ENSMUSP00000036951; ENSMUSG00000042279. [Q8VIK3-1]
ENSMUST00000161969; ENSMUSP00000123797; ENSMUSG00000042279. [Q8VIK3-2]
GeneIDi171506.
KEGGimmu:171506.
UCSCiuc009djl.1. mouse. [Q8VIK3-1]
uc009djm.1. mouse. [Q8VIK3-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY007195 mRNA. Translation: AAG01890.1.
AK135944 mRNA. Translation: BAE22736.1.
AK162137 mRNA. Translation: BAE36747.1.
CH466523 Genomic DNA. Translation: EDK99547.1.
BC137916 mRNA. Translation: AAI37917.1.
CCDSiCCDS20447.1. [Q8VIK3-1]
RefSeqiNP_612184.1. NM_138311.3. [Q8VIK3-1]
XP_006505741.1. XM_006505678.2. [Q8VIK3-2]
UniGeneiMm.21899.

3D structure databases

ProteinModelPortaliQ8VIK3.
SMRiQ8VIK3. Positions 42-126.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000036951.

PTM databases

iPTMnetiQ8VIK3.
PhosphoSiteiQ8VIK3.

Proteomic databases

PaxDbiQ8VIK3.
PRIDEiQ8VIK3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000037831; ENSMUSP00000036951; ENSMUSG00000042279. [Q8VIK3-1]
ENSMUST00000161969; ENSMUSP00000123797; ENSMUSG00000042279. [Q8VIK3-2]
GeneIDi171506.
KEGGimmu:171506.
UCSCiuc009djl.1. mouse. [Q8VIK3-1]
uc009djm.1. mouse. [Q8VIK3-2]

Organism-specific databases

CTDi132243.
MGIiMGI:2176207. H1foo.

Phylogenomic databases

eggNOGiKOG4012. Eukaryota.
ENOG4112541. LUCA.
GeneTreeiENSGT00720000108877.
HOGENOMiHOG000112841.
HOVERGENiHBG096668.
InParanoidiQ8VIK3.
OMAiMNTDEVE.
OrthoDBiEOG091G0LIU.
PhylomeDBiQ8VIK3.
TreeFamiTF333386.

Miscellaneous databases

ChiTaRSiH1foo. mouse.
PROiQ8VIK3.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000042279.
ExpressionAtlasiQ8VIK3. baseline and differential.
GenevisibleiQ8VIK3. MM.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR005818. Histone_H1/H5_H15.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00538. Linker_histone. 1 hit.
[Graphical view]
SMARTiSM00526. H15. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
PROSITEiPS51504. H15. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiH1FOO_MOUSE
AccessioniPrimary (citable) accession number: Q8VIK3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: March 1, 2002
Last modified: September 7, 2016
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.