Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Brain and acute leukemia cytoplasmic protein

Gene

Baalc

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play a synaptic role at the postsynaptic lipid rafts possibly through interaction with CAMK2A.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Brain and acute leukemia cytoplasmic protein
Gene namesi
Name:Baalc
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1928704. Baalc.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse, Synaptosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00002482062 – 145Brain and acute leukemia cytoplasmic proteinAdd BLAST144

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineBy similarity1
Lipidationi3S-palmitoyl cysteineBy similarity1

Post-translational modificationi

Palmitoylation and myristoylation target the protein to the lipid rafts.By similarity

Keywords - PTMi

Lipoprotein, Myristate, Palmitate

Proteomic databases

PaxDbiQ8VHV1.
PRIDEiQ8VHV1.

PTM databases

iPTMnetiQ8VHV1.
PhosphoSitePlusiQ8VHV1.

Expressioni

Tissue specificityi

At the mRNA level, predominantly expressed in the brain (PubMed:11707601). At the protein level, mainly expressed in muscle tissues. In skeletal muscles, expressed in cranial and facial muscles, muscles of the neck, back, thoracic wall, and thigh. Also found in the contractile myoepithelial cell layer of salivary glands. In smooth muscles, expressed in the gastric wall, uterus, urinary bladder, as well as in the muscular lining around seminiferous tubules, prostatic ducts, epididymis, vas deferens, walls of small blood vessels in the dermis, and fascial layers between muscle fibers, brain, and around the spinal cord. Strongly expressed in myocardium. High expression levels are observed in placental spongiotrophoblast and adjacent myometrium. Also expressed in bone marrow hematopoietic cells. In the mature thymus, expressed in rare scattered cells. Weakly expressed in the brain neuropil, particularly near the hippocampus, and spinal cord white matter. Not detected in skin keratinocytes or lung (at protein level) (PubMed:15749074).2 Publications

Developmental stagei

During embryonic development, prominently expressed in muscle tissues, including myocardium, skeletal and smooth muscles, and weakly in the developing central nervous system (only in the neuropil). At 9 dpc, expressed in the wall and trabeculae of the developing heart tube, in the caudal end of the midline dorsal aorta, and a focal area of the mesenchyme around the developing brain. Weakly expressed in marginal and ependymal layers of the early neural tube. At 11-12.5 dpc, expression persists in the myocardium. Scattered signal in the mesoderm on either side of the developing neural tube. Also found in the region of dermatomyotomes. Appears to be associated with the early pre-muscle mesoderm and later with myoblasts and myocytes of the paravertebral, back, body wall and limb muscles. At 13-15 dpc, besides the myocardium, expression is seen in the skeletal muscles of the limbs, intercostal muscles, and the diaphragm, as well as in the developing muscle layer in the wall of the few intestinal coils present in the abdominal cavity. Also found in various components of the mesenchymal precartilage forming the framework of the cranium and the face, notably, the base of the skull, frontonasal process and parts of the primitive maxillary and mandibular processes. Around 13 dpc, detected in the brain lateral ventricles and the roof of the fourth ventricle. At 15 dpc, scattered groups of positive cells are observed in the liver, around the venous sinuses. Weakly expressed in the brain and spinal cord white matter. Prominent membrane expression in the choroid plexus and meninges. At 15-18 dpc, transiently expressed in the layers of ectodermal cells covering the embryo and in immature cells of the lung buds. From 16 dpc to postnatal day 2, no change in the basic pattern of expression (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000022296.
CleanExiMM_BAALC.
GenevisibleiQ8VHV1. MM.

Interactioni

Subunit structurei

Interacts with CAMK2A.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000132788.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni4 – 36Interaction with CAMK2ABy similarityAdd BLAST33

Phylogenomic databases

eggNOGiENOG410J2Z9. Eukaryota.
ENOG410Z0VT. LUCA.
GeneTreeiENSGT00390000013853.
HOGENOMiHOG000253947.
HOVERGENiHBG080887.
InParanoidiQ8VHV1.
OMAiKTSCGTQ.
OrthoDBiEOG091G12CN.
PhylomeDBiQ8VHV1.
TreeFamiTF330767.

Family and domain databases

InterProiView protein in InterPro
IPR009728. BAALC.
PANTHERiPTHR14731. PTHR14731. 1 hit.
PfamiView protein in Pfam
PF06989. BAALC_N. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VHV1-1) [UniParc]FASTAAdd to basket
Also known as: 1-6-8

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCGGSRADA IEPRYYESWT RETESTWLTY TDSDALPSAA ATDSGPEAGG
60 70 80 90 100
LHAGVLEDGL SSNGVLRPAA PGGIANPEKK MNCGTQCPNS QNLSSGPLTQ
110 120 130 140
KQNGLWATEA KRDAKRMSAR EVAINVTENI RQMDRSKRVT KNCIN
Length:145
Mass (Da):15,515
Last modified:January 23, 2007 - v3
Checksum:i4972670A618C4D6D
GO
Isoform 2 (identifier: Q8VHV1-2) [UniParc]FASTAAdd to basket
Also known as: 1-8

The sequence of this isoform differs from the canonical sequence as follows:
     55-145: Missing.

Show »
Length:54
Mass (Da):5,667
Checksum:iFEE8C0EBFBCDB829
GO
Isoform 3 (identifier: Q8VHV1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MGCGGSRADA...SGPEAGGLHA → MPVTPVASGWLLSAHLADPFFDPWAFFSYKS

Show »
Length:123
Mass (Da):13,391
Checksum:i33DFCB5F8CFAA0AB
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0202051 – 53MGCGG…GGLHA → MPVTPVASGWLLSAHLADPF FDPWAFFSYKS in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_02020655 – 145Missing in isoform 2. 2 PublicationsAdd BLAST91

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF371320 mRNA. Translation: AAL50516.1.
AF371324 mRNA. Translation: AAL50520.1.
AK013358 mRNA. Translation: BAB28808.1.
AK079337 mRNA. Translation: BAC37611.1.
BC150479 mRNA. Translation: AAI50480.1.
RefSeqiNP_542371.1. NM_080640.5. [Q8VHV1-1]
UniGeneiMm.233837.

Genome annotation databases

EnsembliENSMUST00000163313; ENSMUSP00000132788; ENSMUSG00000022296. [Q8VHV1-3]
ENSMUST00000202657; ENSMUSP00000144590; ENSMUSG00000107249. [Q8VHV1-3]
GeneIDi118452.
KEGGimmu:118452.
UCSCiuc007vnx.2. mouse. [Q8VHV1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF371320 mRNA. Translation: AAL50516.1.
AF371324 mRNA. Translation: AAL50520.1.
AK013358 mRNA. Translation: BAB28808.1.
AK079337 mRNA. Translation: BAC37611.1.
BC150479 mRNA. Translation: AAI50480.1.
RefSeqiNP_542371.1. NM_080640.5. [Q8VHV1-1]
UniGeneiMm.233837.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000132788.

PTM databases

iPTMnetiQ8VHV1.
PhosphoSitePlusiQ8VHV1.

Proteomic databases

PaxDbiQ8VHV1.
PRIDEiQ8VHV1.

Protocols and materials databases

DNASUi118452.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000163313; ENSMUSP00000132788; ENSMUSG00000022296. [Q8VHV1-3]
ENSMUST00000202657; ENSMUSP00000144590; ENSMUSG00000107249. [Q8VHV1-3]
GeneIDi118452.
KEGGimmu:118452.
UCSCiuc007vnx.2. mouse. [Q8VHV1-1]

Organism-specific databases

CTDi79870.
MGIiMGI:1928704. Baalc.

Phylogenomic databases

eggNOGiENOG410J2Z9. Eukaryota.
ENOG410Z0VT. LUCA.
GeneTreeiENSGT00390000013853.
HOGENOMiHOG000253947.
HOVERGENiHBG080887.
InParanoidiQ8VHV1.
OMAiKTSCGTQ.
OrthoDBiEOG091G12CN.
PhylomeDBiQ8VHV1.
TreeFamiTF330767.

Miscellaneous databases

PROiPR:Q8VHV1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022296.
CleanExiMM_BAALC.
GenevisibleiQ8VHV1. MM.

Family and domain databases

InterProiView protein in InterPro
IPR009728. BAALC.
PANTHERiPTHR14731. PTHR14731. 1 hit.
PfamiView protein in Pfam
PF06989. BAALC_N. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiBAALC_MOUSE
AccessioniPrimary (citable) accession number: Q8VHV1
Secondary accession number(s): A9JR49, Q8VBS8, Q9CYS9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: January 23, 2007
Last modified: June 7, 2017
This is version 99 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.