Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Brain and acute leukemia cytoplasmic protein

Gene

Baalc

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

May play a synaptic role at the postsynaptic lipid rafts by interacting with CAMK2A.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Brain and acute leukemia cytoplasmic protein
Gene namesi
Name:Baalc
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1928704. Baalc.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
  • membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00002482062 – 145Brain and acute leukemia cytoplasmic proteinAdd BLAST144

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineBy similarity1
Lipidationi3S-palmitoyl cysteineBy similarity1

Post-translational modificationi

Palmitoylation and myristoylation target the protein to the lipid rafts.By similarity

Keywords - PTMi

Lipoprotein, Myristate, Palmitate

Proteomic databases

PaxDbiQ8VHV1.
PRIDEiQ8VHV1.

PTM databases

iPTMnetiQ8VHV1.
PhosphoSitePlusiQ8VHV1.

Expressioni

Tissue specificityi

Brain, myocardium, skeletal muscle, smooth muscle of stomach, uterus, urinary bladder, vas deferens, prostatic ducts, epididymis wall and myoepithelial cells in salivary glands.2 Publications

Developmental stagei

Mainly expressed in developing and mature muscle cells (cardiac, skeletal and smooth) beginning on day E9. Expressed in the pre-muscle mesodermal cells of the dermatomyotome regions, and the derivatives of the lateral plate and intermediate mesoderm such as smooth muscle wall of the esophagus, stomach, gut tube, bronchi, small blood vessels and urinary bladder. This pattern continues through the late embryonic stages into adulthood.1 Publication

Gene expression databases

BgeeiENSMUSG00000022296.
CleanExiMM_BAALC.
GenevisibleiQ8VHV1. MM.

Interactioni

Subunit structurei

Interacts with CAMK2A.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000132788.

Structurei

3D structure databases

ProteinModelPortaliQ8VHV1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni4 – 36Interaction with CAMK2ABy similarityAdd BLAST33

Phylogenomic databases

eggNOGiENOG410J2Z9. Eukaryota.
ENOG410Z0VT. LUCA.
GeneTreeiENSGT00390000013853.
HOGENOMiHOG000253947.
HOVERGENiHBG080887.
InParanoidiQ8VHV1.
OMAiSCGTQCS.
OrthoDBiEOG091G12CN.
PhylomeDBiQ8VHV1.
TreeFamiTF330767.

Family and domain databases

InterProiIPR009728. BAALC.
[Graphical view]
PANTHERiPTHR14731. PTHR14731. 1 hit.
PfamiPF06989. BAALC_N. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VHV1-1) [UniParc]FASTAAdd to basket
Also known as: 1-6-8

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGCGGSRADA IEPRYYESWT RETESTWLTY TDSDALPSAA ATDSGPEAGG
60 70 80 90 100
LHAGVLEDGL SSNGVLRPAA PGGIANPEKK MNCGTQCPNS QNLSSGPLTQ
110 120 130 140
KQNGLWATEA KRDAKRMSAR EVAINVTENI RQMDRSKRVT KNCIN
Length:145
Mass (Da):15,515
Last modified:January 23, 2007 - v3
Checksum:i4972670A618C4D6D
GO
Isoform 2 (identifier: Q8VHV1-2) [UniParc]FASTAAdd to basket
Also known as: 1-8

The sequence of this isoform differs from the canonical sequence as follows:
     55-145: Missing.

Show »
Length:54
Mass (Da):5,667
Checksum:iFEE8C0EBFBCDB829
GO
Isoform 3 (identifier: Q8VHV1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MGCGGSRADA...SGPEAGGLHA → MPVTPVASGWLLSAHLADPFFDPWAFFSYKS

Show »
Length:123
Mass (Da):13,391
Checksum:i33DFCB5F8CFAA0AB
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0202051 – 53MGCGG…GGLHA → MPVTPVASGWLLSAHLADPF FDPWAFFSYKS in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_02020655 – 145Missing in isoform 2. 2 PublicationsAdd BLAST91

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF371320 mRNA. Translation: AAL50516.1.
AF371324 mRNA. Translation: AAL50520.1.
AK013358 mRNA. Translation: BAB28808.1.
AK079337 mRNA. Translation: BAC37611.1.
BC150479 mRNA. Translation: AAI50480.1.
RefSeqiNP_542371.1. NM_080640.5. [Q8VHV1-1]
UniGeneiMm.233837.

Genome annotation databases

EnsembliENSMUST00000163313; ENSMUSP00000132788; ENSMUSG00000022296. [Q8VHV1-3]
ENSMUST00000202657; ENSMUSP00000144590; ENSMUSG00000107249. [Q8VHV1-3]
GeneIDi118452.
KEGGimmu:118452.
UCSCiuc007vnx.2. mouse. [Q8VHV1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF371320 mRNA. Translation: AAL50516.1.
AF371324 mRNA. Translation: AAL50520.1.
AK013358 mRNA. Translation: BAB28808.1.
AK079337 mRNA. Translation: BAC37611.1.
BC150479 mRNA. Translation: AAI50480.1.
RefSeqiNP_542371.1. NM_080640.5. [Q8VHV1-1]
UniGeneiMm.233837.

3D structure databases

ProteinModelPortaliQ8VHV1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000132788.

PTM databases

iPTMnetiQ8VHV1.
PhosphoSitePlusiQ8VHV1.

Proteomic databases

PaxDbiQ8VHV1.
PRIDEiQ8VHV1.

Protocols and materials databases

DNASUi118452.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000163313; ENSMUSP00000132788; ENSMUSG00000022296. [Q8VHV1-3]
ENSMUST00000202657; ENSMUSP00000144590; ENSMUSG00000107249. [Q8VHV1-3]
GeneIDi118452.
KEGGimmu:118452.
UCSCiuc007vnx.2. mouse. [Q8VHV1-1]

Organism-specific databases

CTDi79870.
MGIiMGI:1928704. Baalc.

Phylogenomic databases

eggNOGiENOG410J2Z9. Eukaryota.
ENOG410Z0VT. LUCA.
GeneTreeiENSGT00390000013853.
HOGENOMiHOG000253947.
HOVERGENiHBG080887.
InParanoidiQ8VHV1.
OMAiSCGTQCS.
OrthoDBiEOG091G12CN.
PhylomeDBiQ8VHV1.
TreeFamiTF330767.

Miscellaneous databases

PROiQ8VHV1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022296.
CleanExiMM_BAALC.
GenevisibleiQ8VHV1. MM.

Family and domain databases

InterProiIPR009728. BAALC.
[Graphical view]
PANTHERiPTHR14731. PTHR14731. 1 hit.
PfamiPF06989. BAALC_N. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBAALC_MOUSE
AccessioniPrimary (citable) accession number: Q8VHV1
Secondary accession number(s): A9JR49, Q8VBS8, Q9CYS9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: January 23, 2007
Last modified: November 2, 2016
This is version 94 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.