Q8VHL0 (UT1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Urea transporter 1 Alternative name(s): Solute carrier family 14 member 1 Urea transporter B Short name=UT-B Urea transporter, erythrocyte | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 384 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Low-affinity facilitative urea transporter that allow rapid equilibration between the urinary space and the hyperosmotic interstitium. the rate of urea conduction is increased by hypoosmotic stress By similarity. Mediates urea transport in erythrocytes. Ref.1 |
| Subunit structure | Homotrimer By similarity. |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Basolateral cell membrane. Note: Restricted to the basolateral membrane in various portions of the urothelium. Ref.2 |
| Tissue specificity | Expressed in brain, kidney, heart, liver, lung, skeletal muscle, spleen, testis, ureter and urinary bladder (at protein level). Along the gastrointestinal tract, detected in colon, jejunum and stomach (at protein level). In the kidney, expressed in some microvessels of the inner and outer medulla, but not all (at protein level). Not detected in the cortex (at protein level). Detected in the urothelium all along the urinary tract, including the papilla surface, the ureter, the bladder and the urethra (at protein level). In the brain, expressed at the border of the corpus callosum and striatum in astrocytic cellular processes surrounding blood microvessels (at protein level). Ref.1 Ref.2 |
| Induction | Down-regulated by water deprivation in urinary bladder and ureter, but not in kidney medulla, colon, testis nor brain. Ref.2 |
| Post-translational modification | N-glycosylated in red blood cells, as well as in most non-erythroid tissues, except in the gastrocnemius muscle and in the gastrointestinal tract, including liver, colon and stomach. Ref.2 |
| Disruption phenotype | Mutant mice exhibit grossly normal appearance, activity and behavior. Plasma sodium, potassium, chloride, bicarbonate and creatinine concentrations, as well as hematocrit, are similar to wild type animals. Urea permeability in erythrocytes is 45-fold lower than that from wild-type mice. Daily urine output was 1.5-fold greater and urine osmolarity was lower than in wild-type mice. After 24 hours of water deprivation, plasma urea concentration is 30% higher and urine urea concentration 35% lower in mutant mice than in wild-type animals. Ref.1 |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | basolateral plasma membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneTraceable author statement Ref.1. Source: MGI plasma membraneInferred from direct assay PubMed 12133842. Source: MGI |
| Molecular_function | urea transmembrane transporter activity Inferred from mutant phenotype Ref.1. Source: MGI water transmembrane transporter activityInferred from direct assay Ref.1. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8VHL0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8VHL0-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNGQSLTGGTDDAHHGPLWIDPFGNRGDKAAPEGFRRLSLALAQRWREQEPEEEIAM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 384 | 384 | Urea transporter 1 | PRO_0000065738 | |||||
Regions | |||||||||
| Transmembrane | 61 – 81 | 21 | Helical; Potential | ||||||
| Transmembrane | 85 – 105 | 21 | Helical; Potential | ||||||
| Transmembrane | 111 – 131 | 21 | Helical; Potential | ||||||
| Transmembrane | 138 – 158 | 21 | Helical; Potential | ||||||
| Transmembrane | 168 – 188 | 21 | Helical; Potential | ||||||
| Transmembrane | 250 – 270 | 21 | Helical; Potential | ||||||
| Transmembrane | 276 – 296 | 21 | Helical; Potential | ||||||
| Transmembrane | 305 – 325 | 21 | Helical; Potential | ||||||
| Transmembrane | 327 – 347 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 206 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MNGQSLTGGTDDAHHGPLWI DPFGNRGDKAAPEGFRRLSL ALAQRWREQEPEEEIAM in isoform 2. | VSP_041574 | |||||
Experimental info | |||||||||
| Sequence conflict | 8 | 1 | V → A in AAL47138. Ref.1 | ||||||
| Sequence conflict | 50 | 1 | V → A in AAI00571. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Urea-selective concentrating defect in transgenic mice lacking urea transporter UT-B." Yang B., Bankir L., Gillespie A., Epstein C.J., Verkman A.S. J. Biol. Chem. 277:10633-10637(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. Strain: C57BL/6. Tissue: Kidney. |
| [2] | "UT-B1 urea transporter is expressed along the urinary and gastrointestinal tracts of the mouse." Lucien N., Bruneval P., Lasbennes F., Belair M.F., Mandet C., Cartron J.P., Bailly P., Trinh-Trang-Tan M.M. Am. J. Physiol. 288:R1046-R1056(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION, INDUCTION. Strain: BALB/c. Tissue: Kidney. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J and NOD. Tissue: Embryo and Thymus. |
| [4] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6 and C57BL/6NCr. Tissue: Eye, Head and Hematopoietic stem cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF448798 mRNA. Translation: AAL47138.1. AJ420967 mRNA. Translation: CAD12807.1. AK012066 mRNA. Translation: BAB28004.1. AK041979 mRNA. Translation: BAC31119.1. AK153891 mRNA. Translation: BAE32238.1. CH466528 Genomic DNA. Translation: EDL09437.1. CH466528 Genomic DNA. Translation: EDL09438.1. BC058594 mRNA. Translation: AAH58594.2. BC086673 mRNA. Translation: AAH86673.1. BC100570 mRNA. Translation: AAI00571.2. |
| IPI | IPI00420812. IPI00652728. |
| RefSeq | NP_001164481.1. NM_001171010.1. NP_001164482.1. NM_001171011.1. NP_082398.1. NM_028122.4. |
| UniGene | Mm.33832. |
3D structure databases | |
| ProteinModelPortal | Q8VHL0. |
| SMR | Q8VHL0. Positions 31-376. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000025433. |
Proteomic databases | |
| PaxDb | Q8VHL0. |
| PRIDE | Q8VHL0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000091813; ENSMUSP00000089421; ENSMUSG00000059336. ENSMUST00000160292; ENSMUSP00000125114; ENSMUSG00000059336. ENSMUST00000160639; ENSMUSP00000125367; ENSMUSG00000059336. |
| GeneID | 108052. |
| KEGG | mmu:108052. |
Organism-specific databases | |
| CTD | 6563. |
| MGI | MGI:1351654. Slc14a1. |
Phylogenomic databases | |
| eggNOG | COG4413. |
| GeneTree | ENSGT00390000018729. |
| HOGENOM | HOG000065705. |
| HOVERGEN | HBG000540. |
| InParanoid | Q3U542. |
| KO | K08716. |
| OMA | NRIFYLQ. |
| OrthoDB | EOG48D0VG. |
Gene expression databases | |
| Bgee | Q8VHL0. |
| Genevestigator | Q8VHL0. |
| GermOnline | ENSMUSG00000059336. Mus musculus. |
Family and domain databases | |
| InterPro | IPR004937. Urea_transporter. [Graphical view] |
| PANTHER | PTHR10464. PTHR10464. 1 hit. |
| Pfam | PF03253. UT. 1 hit. [Graphical view] |
| PIRSF | PIRSF016502. Urea_transporter. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 359947. |
| SOURCE | Search... |
Entry information
| Entry name | UT1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8VHL0 Secondary accession number(s): Q3U542 Q9CZX3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |

Clusters with
