Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Urea transporter 1

Gene

Slc14a1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei334 – 3341Important for channel permeabilityBy similarity

GO - Molecular functioni

  • urea channel activity Source: UniProtKB
  • urea transmembrane transporter activity Source: MGI
  • water transmembrane transporter activity Source: MGI

GO - Biological processi

  • urea transmembrane transport Source: UniProtKB
  • urea transport Source: MGI
  • water transport Source: MGI
Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_346270. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Names & Taxonomyi

Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name:
UT-B
Urea transporter, erythrocyte
Gene namesi
Name:Slc14a1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:1351654. Slc14a1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Intramembranei47 – 6418HelicalBy similarityAdd
BLAST
Intramembranei68 – 8316HelicalBy similarityAdd
BLAST
Transmembranei86 – 10520HelicalBy similarityAdd
BLAST
Transmembranei110 – 13223HelicalBy similarityAdd
BLAST
Transmembranei139 – 16325HelicalBy similarityAdd
BLAST
Transmembranei168 – 18821HelicalBy similarityAdd
BLAST
Intramembranei215 – 22915HelicalBy similarityAdd
BLAST
Intramembranei234 – 24512HelicalBy similarityAdd
BLAST
Transmembranei250 – 26920HelicalBy similarityAdd
BLAST
Transmembranei279 – 29921HelicalBy similarityAdd
BLAST
Transmembranei304 – 32522HelicalBy similarityAdd
BLAST
Transmembranei328 – 34821HelicalBy similarityAdd
BLAST

GO - Cellular componenti

  • basolateral plasma membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: MGI
  • integral component of plasma membrane Source: UniProtKB
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Disruption phenotypei

Mutant mice exhibit grossly normal appearance, activity and behavior. Plasma sodium, potassium, chloride, bicarbonate and creatinine concentrations, as well as hematocrit, are similar to wild type animals. Urea permeability in erythrocytes is 45-fold lower than that from wild-type mice. Daily urine output is 1.5-fold greater and urine osmolarity is lower than in wild-type mice. After 24 hours of water deprivation, plasma urea concentration is 30% higher and urine urea concentration 35% lower in mutant mice than in wild-type animals. Mice lacking both Aqp1 and Slc14a1 are born at the expected Mendelian ratio, but do not thrive; half of them die within ten days after birth and none are alive after two weeks. Urine osmolality is somewhat lower than that observed with mice lacking Aqp1. Besides, erythrocyte water permeability is significantly lower than in mice lacking only Aqp1.2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 384384Urea transporter 1PRO_0000065738Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

N-glycosylated in red blood cells, as well as in most non-erythroid tissues, except in the gastrocnemius muscle and in the gastrointestinal tract, including liver, colon and stomach.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8VHL0.
PaxDbiQ8VHL0.
PRIDEiQ8VHL0.

Expressioni

Tissue specificityi

Expressed in brain, kidney, heart, liver, lung, skeletal muscle, spleen, testis, ureter and urinary bladder (at protein level). Along the gastrointestinal tract, detected in colon, jejunum and stomach (at protein level). In the kidney, expressed in some microvessels of the inner and outer medulla, but not all (at protein level). Not detected in the cortex (at protein level). Detected in the urothelium all along the urinary tract, including the papilla surface, the ureter, the bladder and the urethra (at protein level). In the brain, expressed at the border of the corpus callosum and striatum in astrocytic cellular processes surrounding blood microvessels (at protein level). Detected in erythrocytes (at protein level).3 Publications

Inductioni

Down-regulated by water deprivation in urinary bladder and ureter, but not in kidney medulla, colon, testis nor brain.1 Publication

Gene expression databases

BgeeiQ8VHL0.
GenevisibleiQ8VHL0. MM.

Interactioni

Subunit structurei

Homotrimer; each subunit contains a pore through which urea permeates. Identified in a complex with STOM (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000125114.

Structurei

3D structure databases

ProteinModelPortaliQ8VHL0.
SMRiQ8VHL0. Positions 31-376.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the urea transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4413.
GeneTreeiENSGT00390000018729.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiQ8VHL0.
KOiK08716.
OMAiVGVGQIY.
OrthoDBiEOG7GBFX8.
TreeFamiTF332858.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VHL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDSPTMVKV DRGENQILSC RGRRCGFKVL GYVTGDMKEF ANWLKDKPVV
60 70 80 90 100
LQFMDWILRG ISQVVFVSNP ISGILILVGL LVQNPWWALC GCVGTVVSTL
110 120 130 140 150
TALLLSQDRS AIAAGLQGYN ATLVGILMAV FSNKGDYFWW LIFPVSAMSM
160 170 180 190 200
TCPVFSSALS SVLSKWDLPV FTLPFNMALS MYLSATGHYN TFFPSKLFTP
210 220 230 240 250
VSSVPNITWS ELSALELLKS LPVGVGQIYG CDNPWTGGIF LCAILLSSPL
260 270 280 290 300
MCLHAAIGSL LGVIAGLSLA APFEDIYFGL WGFNSSLACI AIGGMFMALT
310 320 330 340 350
WQTHLLALAC ALFTAYFGAC MAHLMAVVHL PACTWSFCLA TLLFLLLTTK
360 370 380
NPNIYRMPLS KVTYSEENRI FYLQNKKRMV ESPL
Length:384
Mass (Da):42,126
Last modified:June 28, 2011 - v2
Checksum:iE66ED087341C07B7
GO
Isoform 2 (identifier: Q8VHL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGQSLTGGTDDAHHGPLWIDPFGNRGDKAAPEGFRRLSLALAQRWREQEPEEEIAM

Show »
Length:440
Mass (Da):48,338
Checksum:iBA248DED75D9772A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti8 – 81V → A in AAL47138 (PubMed:11792714).Curated
Sequence conflicti50 – 501V → A in AAI00571 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MNGQSLTGGTDDAHHGPLWI DPFGNRGDKAAPEGFRRLSL ALAQRWREQEPEEEIAM in isoform 2. 1 PublicationVSP_041574

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF448798 mRNA. Translation: AAL47138.1.
AJ420967 mRNA. Translation: CAD12807.1.
AK012066 mRNA. Translation: BAB28004.1.
AK041979 mRNA. Translation: BAC31119.1.
AK153891 mRNA. Translation: BAE32238.1.
CH466528 Genomic DNA. Translation: EDL09437.1.
CH466528 Genomic DNA. Translation: EDL09438.1.
BC058594 mRNA. Translation: AAH58594.2.
BC086673 mRNA. Translation: AAH86673.1.
BC100570 mRNA. Translation: AAI00571.2.
CCDSiCCDS29360.1. [Q8VHL0-1]
CCDS50330.1. [Q8VHL0-2]
RefSeqiNP_001164481.1. NM_001171010.1. [Q8VHL0-2]
NP_001164482.1. NM_001171011.1. [Q8VHL0-1]
NP_082398.1. NM_028122.4. [Q8VHL0-1]
UniGeneiMm.33832.

Genome annotation databases

EnsembliENSMUST00000091813; ENSMUSP00000089421; ENSMUSG00000059336. [Q8VHL0-1]
ENSMUST00000160292; ENSMUSP00000125114; ENSMUSG00000059336. [Q8VHL0-2]
ENSMUST00000160639; ENSMUSP00000125367; ENSMUSG00000059336. [Q8VHL0-1]
GeneIDi108052.
KEGGimmu:108052.
UCSCiuc008fsc.2. mouse. [Q8VHL0-1]
uc008fsd.2. mouse. [Q8VHL0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF448798 mRNA. Translation: AAL47138.1.
AJ420967 mRNA. Translation: CAD12807.1.
AK012066 mRNA. Translation: BAB28004.1.
AK041979 mRNA. Translation: BAC31119.1.
AK153891 mRNA. Translation: BAE32238.1.
CH466528 Genomic DNA. Translation: EDL09437.1.
CH466528 Genomic DNA. Translation: EDL09438.1.
BC058594 mRNA. Translation: AAH58594.2.
BC086673 mRNA. Translation: AAH86673.1.
BC100570 mRNA. Translation: AAI00571.2.
CCDSiCCDS29360.1. [Q8VHL0-1]
CCDS50330.1. [Q8VHL0-2]
RefSeqiNP_001164481.1. NM_001171010.1. [Q8VHL0-2]
NP_001164482.1. NM_001171011.1. [Q8VHL0-1]
NP_082398.1. NM_028122.4. [Q8VHL0-1]
UniGeneiMm.33832.

3D structure databases

ProteinModelPortaliQ8VHL0.
SMRiQ8VHL0. Positions 31-376.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000125114.

Chemistry

BindingDBiQ8VHL0.
ChEMBLiCHEMBL2163171.

Proteomic databases

MaxQBiQ8VHL0.
PaxDbiQ8VHL0.
PRIDEiQ8VHL0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000091813; ENSMUSP00000089421; ENSMUSG00000059336. [Q8VHL0-1]
ENSMUST00000160292; ENSMUSP00000125114; ENSMUSG00000059336. [Q8VHL0-2]
ENSMUST00000160639; ENSMUSP00000125367; ENSMUSG00000059336. [Q8VHL0-1]
GeneIDi108052.
KEGGimmu:108052.
UCSCiuc008fsc.2. mouse. [Q8VHL0-1]
uc008fsd.2. mouse. [Q8VHL0-2]

Organism-specific databases

CTDi6563.
MGIiMGI:1351654. Slc14a1.

Phylogenomic databases

eggNOGiCOG4413.
GeneTreeiENSGT00390000018729.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiQ8VHL0.
KOiK08716.
OMAiVGVGQIY.
OrthoDBiEOG7GBFX8.
TreeFamiTF332858.

Enzyme and pathway databases

ReactomeiREACT_346270. Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.

Miscellaneous databases

NextBioi359947.
PROiQ8VHL0.
SOURCEiSearch...

Gene expression databases

BgeeiQ8VHL0.
GenevisibleiQ8VHL0. MM.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Urea-selective concentrating defect in transgenic mice lacking urea transporter UT-B."
    Yang B., Bankir L., Gillespie A., Epstein C.J., Verkman A.S.
    J. Biol. Chem. 277:10633-10637(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
    Strain: C57BL/6.
    Tissue: Kidney.
  2. "UT-B1 urea transporter is expressed along the urinary and gastrointestinal tracts of the mouse."
    Lucien N., Bruneval P., Lasbennes F., Belair M.F., Mandet C., Cartron J.P., Bailly P., Trinh-Trang-Tan M.M.
    Am. J. Physiol. 288:R1046-R1056(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION, INDUCTION.
    Strain: BALB/c.
    Tissue: Kidney.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J and NOD.
    Tissue: Embryo and Thymus.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6 and C57BL/6NCr.
    Tissue: Eye, Head and Hematopoietic stem cell.
  6. "Analysis of double knockout mice lacking aquaporin-1 and urea transporter UT-B. Evidence for UT-B-facilitated water transport in erythrocytes."
    Yang B., Verkman A.S.
    J. Biol. Chem. 277:36782-36786(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiUT1_MOUSE
AccessioniPrimary (citable) accession number: Q8VHL0
Secondary accession number(s): Q3U542
, Q497G1, Q5RJG2, Q6PDP4, Q9CZX3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2002
Last sequence update: June 28, 2011
Last modified: June 24, 2015
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.