Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Urea transporter 1

Gene

Slc14a1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei334Important for channel permeabilityBy similarity1

GO - Molecular functioni

  • urea channel activity Source: UniProtKB
  • urea transmembrane transporter activity Source: MGI
  • water transmembrane transporter activity Source: MGI

GO - Biological processi

  • urea transmembrane transport Source: UniProtKB
  • urea transport Source: MGI
  • water transport Source: MGI

Keywordsi

Biological processTransport

Enzyme and pathway databases

ReactomeiR-MMU-425366 Transport of bile salts and organic acids, metal ions and amine compounds

Names & Taxonomyi

Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name:
UT-B
Urea transporter, erythrocyte
Gene namesi
Name:Slc14a1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:1351654 Slc14a1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Intramembranei47 – 64HelicalBy similarityAdd BLAST18
Intramembranei68 – 83HelicalBy similarityAdd BLAST16
Transmembranei86 – 105HelicalBy similarityAdd BLAST20
Transmembranei110 – 132HelicalBy similarityAdd BLAST23
Transmembranei139 – 163HelicalBy similarityAdd BLAST25
Transmembranei168 – 188HelicalBy similarityAdd BLAST21
Intramembranei215 – 229HelicalBy similarityAdd BLAST15
Intramembranei234 – 245HelicalBy similarityAdd BLAST12
Transmembranei250 – 269HelicalBy similarityAdd BLAST20
Transmembranei279 – 299HelicalBy similarityAdd BLAST21
Transmembranei304 – 325HelicalBy similarityAdd BLAST22
Transmembranei328 – 348HelicalBy similarityAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Disruption phenotypei

Mutant mice exhibit grossly normal appearance, activity and behavior. Plasma sodium, potassium, chloride, bicarbonate and creatinine concentrations, as well as hematocrit, are similar to wild type animals. Urea permeability in erythrocytes is 45-fold lower than that from wild-type mice. Daily urine output is 1.5-fold greater and urine osmolarity is lower than in wild-type mice. After 24 hours of water deprivation, plasma urea concentration is 30% higher and urine urea concentration 35% lower in mutant mice than in wild-type animals. Mice lacking both Aqp1 and Slc14a1 are born at the expected Mendelian ratio, but do not thrive; half of them die within ten days after birth and none are alive after two weeks. Urine osmolality is somewhat lower than that observed with mice lacking Aqp1. Besides, erythrocyte water permeability is significantly lower than in mice lacking only Aqp1.2 Publications

Chemistry databases

ChEMBLiCHEMBL2163171
GuidetoPHARMACOLOGYi982

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000657381 – 384Urea transporter 1Add BLAST384

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi206N-linked (GlcNAc...) asparagineSequence analysis1
Isoform 2 (identifier: Q8VHL0-2)
Modified residuei39PhosphoserineCombined sources1

Post-translational modificationi

N-glycosylated in red blood cells, as well as in most non-erythroid tissues, except in the gastrocnemius muscle and in the gastrointestinal tract, including liver, colon and stomach.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ8VHL0
PeptideAtlasiQ8VHL0
PRIDEiQ8VHL0

PTM databases

iPTMnetiQ8VHL0
PhosphoSitePlusiQ8VHL0
SwissPalmiQ8VHL0

Expressioni

Tissue specificityi

Expressed in brain, kidney, heart, liver, lung, skeletal muscle, spleen, testis, ureter and urinary bladder (at protein level). Along the gastrointestinal tract, detected in colon, jejunum and stomach (at protein level). In the kidney, expressed in some microvessels of the inner and outer medulla, but not all (at protein level). Not detected in the cortex (at protein level). Detected in the urothelium all along the urinary tract, including the papilla surface, the ureter, the bladder and the urethra (at protein level). In the brain, expressed at the border of the corpus callosum and striatum in astrocytic cellular processes surrounding blood microvessels (at protein level). Detected in erythrocytes (at protein level).3 Publications

Inductioni

Down-regulated by water deprivation in urinary bladder and ureter, but not in kidney medulla, colon, testis nor brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000059336
GenevisibleiQ8VHL0 MM

Interactioni

Subunit structurei

Homotrimer; each subunit contains a pore through which urea permeates. Identified in a complex with STOM (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000125114

Chemistry databases

BindingDBiQ8VHL0

Structurei

3D structure databases

ProteinModelPortaliQ8VHL0
SMRiQ8VHL0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the urea transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEWG Eukaryota
COG4413 LUCA
GeneTreeiENSGT00390000018729
HOGENOMiHOG000065705
HOVERGENiHBG000540
InParanoidiQ8VHL0
KOiK08716
OMAiVGQIYGC
OrthoDBiEOG091G095L
TreeFamiTF332858

Family and domain databases

Gene3Di1.10.3430.10, 1 hit
InterProiView protein in InterPro
IPR029020 Ammonium/urea_transptr
IPR004937 Urea_transporter
PANTHERiPTHR10464 PTHR10464, 1 hit
PfamiView protein in Pfam
PF03253 UT, 1 hit
PIRSFiPIRSF016502 Urea_transporter, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VHL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDSPTMVKV DRGENQILSC RGRRCGFKVL GYVTGDMKEF ANWLKDKPVV
60 70 80 90 100
LQFMDWILRG ISQVVFVSNP ISGILILVGL LVQNPWWALC GCVGTVVSTL
110 120 130 140 150
TALLLSQDRS AIAAGLQGYN ATLVGILMAV FSNKGDYFWW LIFPVSAMSM
160 170 180 190 200
TCPVFSSALS SVLSKWDLPV FTLPFNMALS MYLSATGHYN TFFPSKLFTP
210 220 230 240 250
VSSVPNITWS ELSALELLKS LPVGVGQIYG CDNPWTGGIF LCAILLSSPL
260 270 280 290 300
MCLHAAIGSL LGVIAGLSLA APFEDIYFGL WGFNSSLACI AIGGMFMALT
310 320 330 340 350
WQTHLLALAC ALFTAYFGAC MAHLMAVVHL PACTWSFCLA TLLFLLLTTK
360 370 380
NPNIYRMPLS KVTYSEENRI FYLQNKKRMV ESPL
Length:384
Mass (Da):42,126
Last modified:June 28, 2011 - v2
Checksum:iE66ED087341C07B7
GO
Isoform 2 (identifier: Q8VHL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGQSLTGGTDDAHHGPLWIDPFGNRGDKAAPEGFRRLSLALAQRWREQEPEEEIAM

Show »
Length:440
Mass (Da):48,338
Checksum:iBA248DED75D9772A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8V → A in AAL47138 (PubMed:11792714).Curated1
Sequence conflicti50V → A in AAI00571 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0415741M → MNGQSLTGGTDDAHHGPLWI DPFGNRGDKAAPEGFRRLSL ALAQRWREQEPEEEIAM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF448798 mRNA Translation: AAL47138.1
AJ420967 mRNA Translation: CAD12807.1
AK012066 mRNA Translation: BAB28004.1
AK041979 mRNA Translation: BAC31119.1
AK153891 mRNA Translation: BAE32238.1
CH466528 Genomic DNA Translation: EDL09437.1
CH466528 Genomic DNA Translation: EDL09438.1
BC058594 mRNA Translation: AAH58594.2
BC086673 mRNA Translation: AAH86673.1
BC100570 mRNA Translation: AAI00571.2
CCDSiCCDS29360.1 [Q8VHL0-1]
CCDS50330.1 [Q8VHL0-2]
RefSeqiNP_001164481.1, NM_001171010.1 [Q8VHL0-2]
NP_001164482.1, NM_001171011.1 [Q8VHL0-1]
NP_082398.1, NM_028122.4 [Q8VHL0-1]
UniGeneiMm.33832

Genome annotation databases

EnsembliENSMUST00000091813; ENSMUSP00000089421; ENSMUSG00000059336 [Q8VHL0-1]
ENSMUST00000160292; ENSMUSP00000125114; ENSMUSG00000059336 [Q8VHL0-2]
ENSMUST00000160639; ENSMUSP00000125367; ENSMUSG00000059336 [Q8VHL0-1]
GeneIDi108052
KEGGimmu:108052
UCSCiuc008fsc.2 mouse [Q8VHL0-1]
uc008fsd.2 mouse [Q8VHL0-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiUT1_MOUSE
AccessioniPrimary (citable) accession number: Q8VHL0
Secondary accession number(s): Q3U542
, Q497G1, Q5RJG2, Q6PDP4, Q9CZX3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2002
Last sequence update: June 28, 2011
Last modified: May 23, 2018
This is version 116 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health