Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

Cacnb2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei544Required for CaMK2D-binding1

GO - Molecular functioni

  • actin filament binding Source: BHF-UCL
  • calcium channel regulator activity Source: RGD
  • high voltage-gated calcium channel activity Source: GO_Central
  • phosphoprotein binding Source: RGD
  • protein domain specific binding Source: RGD
  • protein kinase binding Source: RGD
  • voltage-gated calcium channel activity Source: RGD

GO - Biological processi

Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

BRENDAi2.7.4.8. 5301.
ReactomeiR-RNO-400042. Adrenaline,noradrenaline inhibits insulin secretion.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Gene namesi
Name:Cacnb2
Synonyms:Cacnlb2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi67385. Cacnb2.

Subcellular locationi

GO - Cellular componenti

  • L-type voltage-gated calcium channel complex Source: UniProtKB
  • voltage-gated calcium channel complex Source: RGD

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001440541 – 655Voltage-dependent L-type calcium channel subunit beta-2Add BLAST655

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei200PhosphoserineCombined sources1
Modified residuei203PhosphoserineCombined sources1
Modified residuei214PhosphoserineBy similarity1
Modified residuei545PhosphoserineBy similarity1
Modified residuei549Phosphothreonine; by CaMK2D1 Publication1

Post-translational modificationi

Regulated through phosphorylation at Thr-549 by CaMK2D.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8VGC3.
PRIDEiQ8VGC3.

PTM databases

iPTMnetiQ8VGC3.
PhosphoSitePlusiQ8VGC3.
SwissPalmiQ8VGC3.

Expressioni

Tissue specificityi

Highly expressed in heart and brain, and at lower levels in lung.2 Publications

Interactioni

Subunit structurei

Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1S) and the ancillary subunits CACNB1 or CACNB2, CACNG1 and CACNA2D1 (PubMed:26680202). The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio, i.e. it contains either CACNB1 or CACNB2 (PubMed:26680202). Interacts with CACNA1C (PubMed:15141227). Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane (By similarity). Interacts with TMIGD2 (By similarity). Interacts with CAMK2D (PubMed:20194790). Interacts with CBARP (PubMed:24751537).By similarity4 Publications

GO - Molecular functioni

  • actin filament binding Source: BHF-UCL
  • phosphoprotein binding Source: RGD
  • protein domain specific binding Source: RGD
  • protein kinase binding Source: RGD

Protein-protein interaction databases

DIPiDIP-29590N.
IntActiQ8VGC3. 1 interactor.
STRINGi10116.ENSRNOP00000037354.

Structurei

Secondary structure

1655
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi94 – 106Combined sources13
Beta strandi113 – 119Combined sources7
Helixi125 – 127Combined sources3
Beta strandi143 – 149Combined sources7
Beta strandi151 – 161Combined sources11
Beta strandi167 – 170Combined sources4
Helixi172 – 185Combined sources14
Beta strandi270 – 274Combined sources5
Beta strandi280 – 283Combined sources4
Helixi291 – 307Combined sources17
Turni308 – 310Combined sources3
Beta strandi311 – 317Combined sources7
Helixi321 – 323Combined sources3
Beta strandi342 – 345Combined sources4
Helixi347 – 361Combined sources15
Beta strandi366 – 371Combined sources6
Helixi377 – 379Combined sources3
Turni380 – 382Combined sources3
Beta strandi388 – 392Combined sources5
Helixi397 – 406Combined sources10
Helixi415 – 426Combined sources12
Helixi430 – 433Combined sources4
Beta strandi435 – 438Combined sources4
Helixi443 – 461Combined sources19
Helixi464 – 466Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1T0HX-ray1.97A68-196[»]
B254-476[»]
1T0JX-ray2.00A68-196[»]
B254-476[»]
3JBRelectron microscopy4.20B68-196[»]
B254-475[»]
ProteinModelPortaliQ8VGC3.
SMRiQ8VGC3.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8VGC3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini110 – 179SH3PROSITE-ProRule annotationAdd BLAST70

Sequence similaritiesi

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8VGC3.
KOiK04863.
PhylomeDBiQ8VGC3.

Family and domain databases

CDDicd12040. SH3_CACNB2. 1 hit.
InterProiView protein in InterPro
IPR035605. CACNB2_SH3.
IPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
PANTHERiPTHR11824. PTHR11824. 1 hit.
PTHR11824:SF17. PTHR11824:SF17. 1 hit.
PfamiView protein in Pfam
PF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiView protein in SMART
SM00072. GuKc. 1 hit.
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiView protein in PROSITE
PS50002. SH3. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VGC3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQSDTSKSP PIAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG
60 70 80 90 100
SDDSTSSDTT SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ
110 120 130 140 150
AQLEKAKTKP VAFAVRTNVR YSAAQEDDVP VPGMAISFEA KDFLHVKEKF
160 170 180 190 200
NNDWWIGRLV KEGCEIGFIP SPVKLENMRL QHEQRAKQGK FYSSKSGGNS
210 220 230 240 250
SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR SPKPSANSVT
260 270 280 290 300
SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL
310 320 330 340 350
FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV
360 370 380 390 400
QSEIERIFEL ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL
410 420 430 440 450
QRLIKSRGKS QAKHLNVQMV AADKLAQCPP QESFDVILDE NQLEDACEHL
460 470 480 490 500
ADYLEAYWKA THPPSSNLPN PLLSRTLATS TLPLSPTLAS NSQGSQGDQR
510 520 530 540 550
TDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT GRGLSRQETF
560 570 580 590 600
DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREESH SSNGHRHREP
610 620 630 640 650
RHRTRDMGRD QDHNECSKQR SRHKSKDRYC DKEGEVISKR RSEAGEWNRD

VYIRQ
Length:655
Mass (Da):73,226
Last modified:July 5, 2004 - v2
Checksum:i0BD9B42FD4CDF52A
GO
Isoform 2 (identifier: Q8VGC3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSR

Show »
Length:604
Mass (Da):68,175
Checksum:iF877BCC720210351
GO
Isoform 3 (identifier: Q8VGC3-3) [UniParc]FASTAAdd to basket
Also known as: Beta-2c

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MVQSDTSKSPPIAAVAQESQMELLESAAPAGALGAQ → MDQASGLDRLKI

Show »
Length:631
Mass (Da):70,988
Checksum:i5406CA197EC767B4
GO
Isoform 4 (identifier: Q8VGC3-4) [UniParc]FASTAAdd to basket
Also known as: Beta-2e

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGERLKDSDIC

Show »
Length:611
Mass (Da):68,951
Checksum:i4B2044C3C706028D
GO
Isoform 5 (identifier: Q8VGC3-5) [UniParc]FASTAAdd to basket
Also known as: Beta-2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MLDRQLVSSQTQSSIPG

Show »
Length:605
Mass (Da):68,066
Checksum:i262E6837514317A4
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti53D → G in AAO38996 (PubMed:12042350).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0107341 – 67MVQSD…SFVRQ → MQCCGLVHRRRVRVSR in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0107351 – 67MVQSD…SFVRQ → MKATWIRLLKRAKGERLKDS DIC in isoform 4. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0107361 – 67MVQSD…SFVRQ → MLDRQLVSSQTQSSIPG in isoform 5. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0107331 – 36MVQSD…ALGAQ → MDQASGLDRLKI in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF394941 mRNA. Translation: AAL47074.1.
M80545 mRNA. Translation: AAK14821.1.
AF423193 mRNA. Translation: AAL16952.1.
AY190119 mRNA. Translation: AAO38996.1.
AY190120 mRNA. Translation: AAO38997.1.
PIRiA42044.
RefSeqiNP_446303.1. NM_053851.1.
XP_006254360.1. XM_006254298.3.
XP_006254365.1. XM_006254303.3. [Q8VGC3-5]
UniGeneiRn.10739.

Genome annotation databases

GeneIDi116600.
KEGGirno:116600.
UCSCiRGD:67385. rat. [Q8VGC3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCACB2_RAT
AccessioniPrimary (citable) accession number: Q8VGC3
Secondary accession number(s): Q811Q6
, Q811Q7, Q91ZJ8, Q9QUU7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: July 5, 2004
Last modified: August 30, 2017
This is version 123 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families