Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

Cacnb2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.By similarity3 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei544 – 5441Required for CaMK2D-binding

GO - Molecular functioni

  • calcium channel regulator activity Source: RGD
  • phosphoprotein binding Source: RGD
  • protein domain specific binding Source: RGD
  • protein kinase binding Source: RGD
  • voltage-gated calcium channel activity Source: RGD

GO - Biological processi

  • calcium ion transport Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BRENDAi2.7.4.8. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Gene namesi
Name:Cacnb2
Synonyms:Cacnlb2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi67385. Cacnb2.

Subcellular locationi

GO - Cellular componenti

  • sarcolemma Source: UniProtKB-SubCell
  • voltage-gated calcium channel complex Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 655655Voltage-dependent L-type calcium channel subunit beta-2PRO_0000144054Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei200 – 2001PhosphoserineCombined sources
Modified residuei203 – 2031PhosphoserineCombined sources
Modified residuei214 – 2141PhosphoserineBy similarity
Modified residuei545 – 5451PhosphoserineBy similarity
Modified residuei549 – 5491Phosphothreonine; by CaMK2D1 Publication

Post-translational modificationi

Regulated through phosphorylation at Thr-549 by CaMK2D.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8VGC3.
PRIDEiQ8VGC3.

PTM databases

iPTMnetiQ8VGC3.
PhosphoSiteiQ8VGC3.
SwissPalmiQ8VGC3.

Expressioni

Tissue specificityi

Highly expressed in heart and brain, and at lower levels in lung.2 Publications

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane (By similarity). Interacts with CAMK2D. Interacts with CBARP.By similarity3 Publications

GO - Molecular functioni

  • phosphoprotein binding Source: RGD
  • protein domain specific binding Source: RGD
  • protein kinase binding Source: RGD

Protein-protein interaction databases

DIPiDIP-29590N.
IntActiQ8VGC3. 1 interaction.
STRINGi10116.ENSRNOP00000037354.

Structurei

Secondary structure

1
655
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi94 – 10613Combined sources
Beta strandi113 – 1197Combined sources
Helixi125 – 1273Combined sources
Beta strandi143 – 1497Combined sources
Beta strandi151 – 16111Combined sources
Beta strandi167 – 1704Combined sources
Helixi172 – 18514Combined sources
Beta strandi270 – 2745Combined sources
Beta strandi280 – 2834Combined sources
Helixi291 – 30717Combined sources
Turni308 – 3103Combined sources
Beta strandi311 – 3177Combined sources
Helixi321 – 3233Combined sources
Beta strandi342 – 3454Combined sources
Helixi347 – 36115Combined sources
Beta strandi366 – 3716Combined sources
Helixi377 – 3793Combined sources
Turni380 – 3823Combined sources
Beta strandi388 – 3925Combined sources
Helixi397 – 40610Combined sources
Helixi415 – 42612Combined sources
Helixi430 – 4334Combined sources
Beta strandi435 – 4384Combined sources
Helixi443 – 46119Combined sources
Helixi464 – 4663Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1T0HX-ray1.97A68-196[»]
B254-476[»]
1T0JX-ray2.00A68-196[»]
B254-476[»]
3JBRelectron microscopy4.20B68-196[»]
B254-475[»]
ProteinModelPortaliQ8VGC3.
SMRiQ8VGC3. Positions 84-462.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8VGC3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini110 – 17970SH3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8VGC3.
KOiK04863.
OrthoDBiEOG7966G4.
PhylomeDBiQ8VGC3.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VGC3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQSDTSKSP PIAAVAQESQ MELLESAAPA GALGAQSYGK GARRKNRFKG
60 70 80 90 100
SDDSTSSDTT SNSFVRQGSA DSYTSRPSDS DVSLEEDREA VRREAERQAQ
110 120 130 140 150
AQLEKAKTKP VAFAVRTNVR YSAAQEDDVP VPGMAISFEA KDFLHVKEKF
160 170 180 190 200
NNDWWIGRLV KEGCEIGFIP SPVKLENMRL QHEQRAKQGK FYSSKSGGNS
210 220 230 240 250
SSSLGDIVPS SRKSTPPSSA IDIDATGLDA EENDIPANHR SPKPSANSVT
260 270 280 290 300
SPHSKEKRMP FFKKTEHTPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL
310 320 330 340 350
FDFLKHRFEG RISITRVTAD ISLAKRSVLN NPSKHAIIER SNTRSSLAEV
360 370 380 390 400
QSEIERIFEL ARTLQLVVLD ADTINHPAQL SKTSLAPIIV YVKISSPKVL
410 420 430 440 450
QRLIKSRGKS QAKHLNVQMV AADKLAQCPP QESFDVILDE NQLEDACEHL
460 470 480 490 500
ADYLEAYWKA THPPSSNLPN PLLSRTLATS TLPLSPTLAS NSQGSQGDQR
510 520 530 540 550
TDRSAPRSAS QAEEEPCLEP VKKSQHRSSS ATHQNHRSGT GRGLSRQETF
560 570 580 590 600
DSETQESRDS AYVEPKEDYS HEHVDRYVPH REHNHREESH SSNGHRHREP
610 620 630 640 650
RHRTRDMGRD QDHNECSKQR SRHKSKDRYC DKEGEVISKR RSEAGEWNRD

VYIRQ
Length:655
Mass (Da):73,226
Last modified:July 5, 2004 - v2
Checksum:i0BD9B42FD4CDF52A
GO
Isoform 2 (identifier: Q8VGC3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MQCCGLVHRRRVRVSR

Show »
Length:604
Mass (Da):68,175
Checksum:iF877BCC720210351
GO
Isoform 3 (identifier: Q8VGC3-3) [UniParc]FASTAAdd to basket

Also known as: Beta-2c

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MVQSDTSKSPPIAAVAQESQMELLESAAPAGALGAQ → MDQASGLDRLKI

Show »
Length:631
Mass (Da):70,988
Checksum:i5406CA197EC767B4
GO
Isoform 4 (identifier: Q8VGC3-4) [UniParc]FASTAAdd to basket

Also known as: Beta-2e

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MKATWIRLLKRAKGERLKDSDIC

Show »
Length:611
Mass (Da):68,951
Checksum:i4B2044C3C706028D
GO
Isoform 5 (identifier: Q8VGC3-5) [UniParc]FASTAAdd to basket

Also known as: Beta-2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MVQSDTSKSP...DTTSNSFVRQ → MLDRQLVSSQTQSSIPG

Show »
Length:605
Mass (Da):68,066
Checksum:i262E6837514317A4
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti53 – 531D → G in AAO38996 (PubMed:12042350).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6767MVQSD…SFVRQ → MQCCGLVHRRRVRVSR in isoform 2. 1 PublicationVSP_010734Add
BLAST
Alternative sequencei1 – 6767MVQSD…SFVRQ → MKATWIRLLKRAKGERLKDS DIC in isoform 4. 1 PublicationVSP_010735Add
BLAST
Alternative sequencei1 – 6767MVQSD…SFVRQ → MLDRQLVSSQTQSSIPG in isoform 5. 1 PublicationVSP_010736Add
BLAST
Alternative sequencei1 – 3636MVQSD…ALGAQ → MDQASGLDRLKI in isoform 3. 1 PublicationVSP_010733Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF394941 mRNA. Translation: AAL47074.1.
M80545 mRNA. Translation: AAK14821.1.
AF423193 mRNA. Translation: AAL16952.1.
AY190119 mRNA. Translation: AAO38996.1.
AY190120 mRNA. Translation: AAO38997.1.
PIRiA42044.
RefSeqiNP_446303.1. NM_053851.1.
XP_006254360.1. XM_006254298.2.
XP_006254365.1. XM_006254303.2. [Q8VGC3-5]
UniGeneiRn.10739.

Genome annotation databases

GeneIDi116600.
KEGGirno:116600.
UCSCiRGD:67385. rat. [Q8VGC3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF394941 mRNA. Translation: AAL47074.1.
M80545 mRNA. Translation: AAK14821.1.
AF423193 mRNA. Translation: AAL16952.1.
AY190119 mRNA. Translation: AAO38996.1.
AY190120 mRNA. Translation: AAO38997.1.
PIRiA42044.
RefSeqiNP_446303.1. NM_053851.1.
XP_006254360.1. XM_006254298.2.
XP_006254365.1. XM_006254303.2. [Q8VGC3-5]
UniGeneiRn.10739.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1T0HX-ray1.97A68-196[»]
B254-476[»]
1T0JX-ray2.00A68-196[»]
B254-476[»]
3JBRelectron microscopy4.20B68-196[»]
B254-475[»]
ProteinModelPortaliQ8VGC3.
SMRiQ8VGC3. Positions 84-462.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-29590N.
IntActiQ8VGC3. 1 interaction.
STRINGi10116.ENSRNOP00000037354.

PTM databases

iPTMnetiQ8VGC3.
PhosphoSiteiQ8VGC3.
SwissPalmiQ8VGC3.

Proteomic databases

PaxDbiQ8VGC3.
PRIDEiQ8VGC3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi116600.
KEGGirno:116600.
UCSCiRGD:67385. rat. [Q8VGC3-1]

Organism-specific databases

CTDi783.
RGDi67385. Cacnb2.

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiQ8VGC3.
KOiK04863.
OrthoDBiEOG7966G4.
PhylomeDBiQ8VGC3.

Enzyme and pathway databases

BRENDAi2.7.4.8. 5301.

Miscellaneous databases

EvolutionaryTraceiQ8VGC3.
NextBioi619307.
PROiQ8VGC3.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of a cardiac/brain beta subunit of the L-type calcium channel."
    Perez-Reyes E., Castellano A., Kim H.S., Bertrand P., Baggstrom E., Lacerda A.E., Wei X.Y., Birnbaumer L.
    J. Biol. Chem. 267:1792-1797(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING.
    Tissue: Brain.
  2. "Cloning of a functional splice variant of L-type calcium channel beta2 subunit from rat heart."
    Yamada Y., Nagashima M., Tsutsuura M., Kobayashi T., Seki S., Makita N., Horio Y., Tohse N.
    J. Biol. Chem. 276:47163-47170(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING.
    Strain: Wistar.
    Tissue: Heart.
  3. "Novel functional properties of Ca(2+) channel beta subunits revealed by their expression in adult rat heart cells."
    Colecraft H.M., Alseikhan B., Takahashi S.X., Chaudhuri D., Mittman S., Yegnasubramanian V., Alvania R.S., Johns D.C., Marban E., Yue D.T.
    J. Physiol. (Lond.) 541:435-452(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5), FUNCTION, SUBCELLULAR LOCATION.
    Strain: Sprague-Dawley.
    Tissue: Heart.
  4. "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."
    Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.
    Nat. Commun. 3:876-876(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-200 AND SER-203, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  5. Cited for: INTERACTION WITH CAMK2D, PHOSPHORYLATION AT THR-549 BY CAMK2D.
  6. Cited for: INTERACTION WITH CBARP.
  7. "Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain."
    Van Petegem F., Clark K.A., Chatelain F.C., Minor D.L. Jr.
    Nature 429:671-675(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 68-476 IN COMPLEX WITH CACNA1C.

Entry informationi

Entry nameiCACB2_RAT
AccessioniPrimary (citable) accession number: Q8VGC3
Secondary accession number(s): Q811Q6
, Q811Q7, Q91ZJ8, Q9QUU7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: July 5, 2004
Last modified: May 11, 2016
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.