Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein CEP57L1

Gene

Cep57l1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Centrosomal protein which may be required for microtubule attachment to centrosomes.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein CEP57L1
Alternative name(s):
Centrosomal protein 57kDa-like protein 1
Centrosomal protein of 57 kDa-related protein
Short name:
Cep57R
Cep57-related protein
Gene namesi
Name:Cep57l1
Synonyms:Cep57r
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1915511. Cep57l1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 400400Centrosomal protein CEP57L1PRO_0000189535Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei45 – 451PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8VDS7.
PRIDEiQ8VDS7.

PTM databases

PhosphoSiteiQ8VDS7.

Expressioni

Gene expression databases

CleanExiMM_2410017P07RIK.

Interactioni

GO - Molecular functioni

Structurei

3D structure databases

ProteinModelPortaliQ8VDS7.
SMRiQ8VDS7. Positions 262-333.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili47 – 11165Sequence analysisAdd
BLAST
Coiled coili138 – 21376Sequence analysisAdd
BLAST
Coiled coili261 – 34585Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the translokin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

InParanoidiQ8VDS7.
KOiK16762.
PhylomeDBiQ8VDS7.

Family and domain databases

InterProiIPR010597. Centrosomal_protein_57kDa.
IPR025913. Cep57_CLD.
IPR024957. Cep57_MT-bd_dom.
[Graphical view]
PANTHERiPTHR19336:SF10. PTHR19336:SF10. 1 hit.
PfamiPF14073. Cep57_CLD. 1 hit.
PF06657. Cep57_MT_bd. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8VDS7-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSELSQSMV GSYLNPPERM HLPSFTQNEA FQNCHPGTPP KMFNSPNNQA
60 70 80 90 100
LVSALKTLQE KIRRLELERT QAEDNLNLLS REAAQYKKAL EEETNERNLA
110 120 130 140 150
HQELIKQKKD ISIQLSSAQS RCILLEKQLE YTKRMVLNVE REKTMILEQQ
160 170 180 190 200
AQLQREKEQD QMKLHAKLEK LHVLEKECLR LTATRQTAED KIKCLEEKLK
210 220 230 240 250
EEEHQRRLFQ DRACEKTNCL KREPPQQRDH KFRTPTFERK KPFRTTSQAR
260 270 280 290 300
ANPQSSGEPV SICDSLSELL MTMEEELDQM NMEHRELLRQ TMQPGNHSVS
310 320 330 340 350
EDIEQELEQL AKKMESKGDQ ISKLKKHQDS VRKLQEKIEN SRINESSGIH
360 370 380 390 400
GNPKGSKNLK TSPRKCVSET SSFQRDRGFQ PVQVHSLQSK LRRDDIKWEQ
Length:400
Mass (Da):46,790
Last modified:March 1, 2002 - v1
Checksum:iE0EE017BE1310C66
GO
Isoform 2 (identifier: Q8VDS7-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-125: Missing.
     215-215: E → ELQTGFEISKILMSTVSNSKHCKEKKKQPK

Show »
Length:353
Mass (Da):41,335
Checksum:i72E78E1A1D47B848
GO
Isoform 3 (identifier: Q8VDS7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-256: KTNCLKREPP...SQARANPQSS → LQTGFEISKI...YIQLIPDITS
     257-400: Missing.

Show »
Length:256
Mass (Da):30,004
Checksum:i97C2E1CDED16DF4A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti291 – 2911T → M in BAB28426 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei50 – 12576Missing in isoform 2. 1 PublicationVSP_013897Add
BLAST
Alternative sequencei215 – 2151E → ELQTGFEISKILMSTVSNSK HCKEKKKQPK in isoform 2. 1 PublicationVSP_013898
Alternative sequencei216 – 25641KTNCL…NPQSS → LQTGFEISKILMSTVSNSKH CKEKKKQPKVYYIQLIPDIT S in isoform 3. 1 PublicationVSP_013899Add
BLAST
Alternative sequencei257 – 400144Missing in isoform 3. 1 PublicationVSP_013900Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK012710 mRNA. Translation: BAB28426.1.
AK015619 mRNA. Translation: BAB29907.1.
BC021375 mRNA. Translation: AAH21375.1.
CCDSiCCDS23808.1. [Q8VDS7-3]
RefSeqiNP_001230003.1. NM_001243074.1.
NP_001230004.1. NM_001243075.1.
UniGeneiMm.338605.
Mm.445901.

Genome annotation databases

GeneIDi103268.
KEGGimmu:103268.
UCSCiuc007eya.2. mouse. [Q8VDS7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK012710 mRNA. Translation: BAB28426.1.
AK015619 mRNA. Translation: BAB29907.1.
BC021375 mRNA. Translation: AAH21375.1.
CCDSiCCDS23808.1. [Q8VDS7-3]
RefSeqiNP_001230003.1. NM_001243074.1.
NP_001230004.1. NM_001243075.1.
UniGeneiMm.338605.
Mm.445901.

3D structure databases

ProteinModelPortaliQ8VDS7.
SMRiQ8VDS7. Positions 262-333.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiQ8VDS7.

Proteomic databases

MaxQBiQ8VDS7.
PRIDEiQ8VDS7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi103268.
KEGGimmu:103268.
UCSCiuc007eya.2. mouse. [Q8VDS7-1]

Organism-specific databases

CTDi285753.
MGIiMGI:1915511. Cep57l1.

Phylogenomic databases

InParanoidiQ8VDS7.
KOiK16762.
PhylomeDBiQ8VDS7.

Miscellaneous databases

ChiTaRSiCep57l1. mouse.
PROiQ8VDS7.
SOURCEiSearch...

Gene expression databases

CleanExiMM_2410017P07RIK.

Family and domain databases

InterProiIPR010597. Centrosomal_protein_57kDa.
IPR025913. Cep57_CLD.
IPR024957. Cep57_MT-bd_dom.
[Graphical view]
PANTHERiPTHR19336:SF10. PTHR19336:SF10. 1 hit.
PfamiPF14073. Cep57_CLD. 1 hit.
PF06657. Cep57_MT_bd. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCE57L_MOUSE
AccessioniPrimary (citable) accession number: Q8VDS7
Secondary accession number(s): Q9CZE0, Q9D5A1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: March 1, 2002
Last modified: September 7, 2016
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.